Details of the Target
General Information of Target
Target ID | LDTP04717 | |||||
---|---|---|---|---|---|---|
Target Name | Small ubiquitin-related modifier 3 (SUMO3) | |||||
Gene Name | SUMO3 | |||||
Gene ID | 6612 | |||||
Synonyms |
SMT3A; SMT3H1; Small ubiquitin-related modifier 3; SUMO-3; SMT3 homolog 1; SUMO-2; Ubiquitin-like protein SMT3A; Smt3A |
|||||
3D Structure | ||||||
Sequence |
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
|||||
Target Bioclass |
Other
|
|||||
Family |
Ubiquitin family, SUMO subfamily
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
P2 Probe Info |
![]() |
2.10 | LDD0449 | [1] | |
P3 Probe Info |
![]() |
1.82 | LDD0450 | [1] | |
ONAyne Probe Info |
![]() |
K32(1.02) | LDD0274 | [2] | |
STPyne Probe Info |
![]() |
K32(4.46); K41(5.88); K44(5.26) | LDD0277 | [2] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [3] | |
AMP probe Probe Info |
![]() |
K32(0.00); K34(0.00) | LDD0200 | [4] | |
ATP probe Probe Info |
![]() |
K32(0.00); K34(0.00); K41(0.00); K11(0.00) | LDD0199 | [4] | |
ATP probe Probe Info |
![]() |
K32(0.00); K41(0.00) | LDD0035 | [5] | |
HHS-465 Probe Info |
![]() |
K32(0.00); K44(0.00); Y46(0.00); K41(0.00) | LDD2240 | [6] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
SUMO-specific isopeptidase USPL1 (USPL1) | Peptidase C19 family | Q5W0Q7 | |||
Sentrin-specific protease 2 (SENP2) | Peptidase C48 family | Q9HC62 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Huntingtin (HTT) | Huntingtin family | P42858 |
Transcription factor
Other
References