Details of the Target

General Information of Target

Target ID LDTP03768
Target Name Alpha-actinin-2 (ACTN2)
Gene Name ACTN2
Gene ID 88
Synonyms
Alpha-actinin-2; Alpha-actinin skeletal muscle isoform 2; F-actin cross-linking protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
Target Bioclass
Transporter and channel
Family
Alpha-actinin family
Subcellular location
Cytoplasm, myofibril, sarcomere, Z line
Function F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Uniprot ID
P35609
Ensemble ID
ENST00000366578.6
HGNC ID
HGNC:164

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAMA1 SNV: p.S201Ter DBIA    Probe Info 
CCK81 SNV: p.A35S DBIA    Probe Info 
DU145 SNV: p.K842T DBIA    Probe Info 
HGC27 SNV: p.M798I DBIA    Probe Info 
HT115 SNV: p.E382D DBIA    Probe Info 
IGR37 SNV: p.D17N DBIA    Probe Info 
IGR39 SNV: p.D17N DBIA    Probe Info 
IGROV1 SNV: p.K331R DBIA    Probe Info 
KYSE510 SNV: p.E82K DBIA    Probe Info 
LNCaP clone FGC SNV: p.L434P DBIA    Probe Info 
LOXIMVI SNV: p.R852W DBIA    Probe Info 
LS180 SNV: p.P843S DBIA    Probe Info 
MCC13 SNV: p.G697R DBIA    Probe Info 
NCIH1944 SNV: p.L565Q DBIA    Probe Info 
NCIH2170 SNV: p.R501S DBIA    Probe Info 
NCIH2172 SNV: p.Q460H DBIA    Probe Info 
RKN SNV: p.I137V DBIA    Probe Info 
RL952 SNV: p.Y19H DBIA    Probe Info 
SNU308 SNV: p.A882S DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
ONAyne
 Probe Info  		K405(10.00)  LDD0274  [1]
AZ-9
 Probe Info  		E155(10.00)  LDD2208  [2]
DBIA
 Probe Info  		C351(2.23); C173(3.56)  LDD3311  [3]
AHL-Pu-1
 Probe Info  		C161(2.26)  LDD0168  [4]
HHS-475
 Probe Info  		Y715(0.64)  LDD0264  [5]
Acrolein
 Probe Info  		N.A.  LDD0221  [6]
CY-1
 Probe Info  		N.A.  LDD0246  [7]
HHS-465
 Probe Info  		Y715(0.00); K42(0.00)  LDD2240  [8]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C322
 Probe Info  		6.54  LDD1988  [9]
STS-2
 Probe Info  		N.A.  LDD0138  [10]
STS-1
 Probe Info  		N.A.  LDD0068  [11]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA HEK-293T C161(2.26)  LDD0168  [4]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [6]
 LDCM0116  HHS-0101 DM93 Y715(0.64)  LDD0264  [5]
 LDCM0117  HHS-0201 DM93 Y715(0.56)  LDD0265  [5]
 LDCM0118  HHS-0301 DM93 Y715(0.61)  LDD0266  [5]
 LDCM0119  HHS-0401 DM93 Y715(0.63)  LDD0267  [5]
 LDCM0120  HHS-0701 DM93 Y715(0.68)  LDD0268  [5]
 LDCM0107  IAA HeLa N.A.  LDD0221  [6]
 LDCM0022  KB02 22RV1 C351(2.04); C173(3.13)  LDD2243  [3]
 LDCM0023  KB03 22RV1 C351(2.70); C173(5.62)  LDD2660  [3]
 LDCM0024  KB05 G361 C351(2.23); C173(3.56)  LDD3311  [3]
 LDCM0109  NEM HeLa N.A.  LDD0223  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Katanin p60 ATPase-containing subunit A-like 2 (KATNAL2) AAA ATPase family Q8IYT4
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Ribonuclease P protein subunit p14 (RPP14) Eukaryotic/archaeal RNase P protein component 2 family O95059
Glutathione S-transferase theta-1 (GSTT1) Theta family P30711
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Angiogenin (ANG) Pancreatic ribonuclease family P03950
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) PPP phosphatase family P62140
Titin (TTN) CAMK Ser/Thr protein kinase family Q8WZ42
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Alpha-actinin-2 (ACTN2) Alpha-actinin family P35609
ATP synthase F(0) complex subunit C1, mitochondrial (ATP5MC1) ATPase C chain family P05496
Golgin subfamily A member 7 (GOLGA7) ERF4 family Q7Z5G4
Potassium voltage-gated channel subfamily A member 5 (KCNA5) Potassium channel family P22460
Small conductance calcium-activated potassium channel protein 2 (KCNN2) Potassium channel KCNN family Q9H2S1
Signal recognition particle 9 kDa protein (SRP9) SRP9 family P49458
Small ribosomal subunit protein RACK1 (RACK1) WD repeat G protein beta family P63244
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein SNAI1 (SNAI1) Snail C2H2-type zinc-finger protein family O95863
Nuclear autoantigen Sp-100 (SP100) . P23497
Trans-acting T-cell-specific transcription factor GATA-3 (GATA3) . P23771
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-hydroxytryptamine receptor 1B (HTR1B) G-protein coupled receptor 1 family P28222
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Myotilin (MYOT) Myotilin/palladin family Q9UBF9
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CD27 antigen (CD27) . P26842
Other
Click To Hide/Show 24 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-1 (ACTN1) Alpha-actinin family P12814
Bcl2-associated agonist of cell death (BAD) Bcl-2 family Q92934
Breast cancer metastasis-suppressor 1-like protein (BRMS1L) BRMS1 family Q5PSV4
Cellular retinoic acid-binding protein 2 (CRABP2) Fatty-acid binding protein (FABP) family P29373
Dynein light chain Tctex-type protein 2B (DYNLT2B) Dynein light chain Tctex-type family Q8WW35
Stabilizer of axonemal microtubules 1 (SAXO1) FAM154 family Q8IYX7
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Histone H4 (H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16) Histone H4 family P62805
Myozenin-2 (MYOZ2) Myozenin family Q9NPC6
Ciliary microtubule associated protein 1B (CIMAP1B) ODF3 family A8MYP8
Toll-interacting protein (TOLLIP) Tollip family Q9H0E2
Large ribosomal subunit protein uL10m (MRPL10) Universal ribosomal protein uL10 family Q7Z7H8
Angiopoietin-related protein 7 (ANGPTL7) . O43827
C-type lectin domain family 4 member D (CLEC4D) . Q8WXI8
Cysteine and glycine-rich protein 3 (CSRP3) . P50461
Death domain-containing protein CRADD (CRADD) . P78560
Disrupted in schizophrenia 1 protein (DISC1) . Q9NRI5
MICAL-like protein 2 (MICALL2) . Q8IY33
Nebulin-related-anchoring protein (NRAP) . Q86VF7
PDZ and LIM domain protein 3 (PDLIM3) . Q53GG5
Protein ZNRD2 (ZNRD2) . O60232
Receptor-transporting protein 5 (RTP5) . Q14D33
Sperm surface protein Sp17 (SPA17) . Q15506
Uncharacterized protein NKAPD1 (NKAPD1) . Q6ZUT1

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
5 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
6 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
7 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
8 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
9 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
10 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
11 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.