Details of the Target
General Information of Target
| Target ID | LDTP03051 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-related protein Rab-6A (RAB6A) | |||||
| Gene Name | RAB6A | |||||
| Gene ID | 5870 | |||||
| Synonyms |
RAB6; Ras-related protein Rab-6A; Rab-6 |
|||||
| 3D Structure | ||||||
| Sequence |
MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST QDRSREDMIDIKLEKPQEQPVSEGGCSC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rab family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Regulator of COPI-independent retrograde transport from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity. Recruits VPS13B to the Golgi membrane. Plays a role in neuron projection development (Probable).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K133(9.55); K164(10.00) | LDD0277 | [1] | |
|
AZ-9 Probe Info |
![]() |
E58(1.06) | LDD2208 | [2] | |
|
Probe 1 Probe Info |
![]() |
Y161(40.84) | LDD3495 | [3] | |
|
Jackson_14 Probe Info |
![]() |
2.63 | LDD0123 | [4] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [5] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [6] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C232 Probe Info |
![]() |
41.07 | LDD1905 | [7] | |
|
C235 Probe Info |
![]() |
24.59 | LDD1908 | [7] | |
|
STS-2 Probe Info |
![]() |
N.A. | LDD0138 | [8] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amyloid-beta precursor protein (APP) | APP family | P05067 | |||
Other
References









