Details of the Target
General Information of Target
Target ID | LDTP02982 | |||||
---|---|---|---|---|---|---|
Target Name | Myosin regulatory light chain 12A (MYL12A) | |||||
Gene Name | MYL12A | |||||
Gene ID | 10627 | |||||
Synonyms |
MLCB; MRLC3; RLC; Myosin regulatory light chain 12A; Epididymis secretory protein Li 24; HEL-S-24; MLC-2B; Myosin RLC; Myosin regulatory light chain 2, nonsarcomeric; Myosin regulatory light chain MRLC3
|
|||||
3D Structure | ||||||
Sequence |
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
|||||
Target Bioclass |
Other
|
|||||
Function |
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
CY-1 Probe Info |
![]() |
100.00 | LDD0243 | [2] | |
CY4 Probe Info |
![]() |
100.00 | LDD0244 | [2] | |
FBP2 Probe Info |
![]() |
2.79 | LDD0323 | [3] | |
ONAyne Probe Info |
![]() |
K149(2.00); K150(5.88); K163(2.62) | LDD0274 | [4] | |
STPyne Probe Info |
![]() |
K149(3.23); K150(8.21); K163(4.76) | LDD0277 | [4] | |
AZ-9 Probe Info |
![]() |
E124(1.31); D131(10.00) | LDD2208 | [5] | |
IA-alkyne Probe Info |
![]() |
C108(2.75) | LDD2157 | [6] | |
HHS-475 Probe Info |
![]() |
Y121(0.63) | LDD0264 | [7] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [8] | |
IPM Probe Info |
![]() |
N.A. | LDD2156 | [9] | |
Acrolein Probe Info |
![]() |
H54(0.00); C108(0.00) | LDD0217 | [10] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [10] | |
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [10] | |
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [11] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0108 | Chloroacetamide | HeLa | C108(0.00); H54(0.00) | LDD0222 | [10] |
LDCM0116 | HHS-0101 | DM93 | Y121(0.63) | LDD0264 | [7] |
LDCM0119 | HHS-0401 | DM93 | Y121(0.65) | LDD0267 | [7] |
LDCM0120 | HHS-0701 | DM93 | Y121(0.50) | LDD0268 | [7] |
LDCM0107 | IAA | HeLa | C108(0.00); H54(0.00) | LDD0221 | [10] |
LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [10] |
The Interaction Atlas With This Target
References