Details of the Target
General Information of Target
Target ID | LDTP02148 | |||||
---|---|---|---|---|---|---|
Target Name | Prothymosin alpha (PTMA) | |||||
Gene Name | PTMA | |||||
Gene ID | 5757 | |||||
Synonyms |
TMSA; Prothymosin alpha [Cleaved into: Prothymosin alpha, N-terminally processed; Thymosin alpha-1] |
|||||
3D Structure | ||||||
Sequence |
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEG
GEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD |
|||||
Target Bioclass |
Other
|
|||||
Family |
Pro/parathymosin family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function | Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
AZ-9 Probe Info |
![]() |
9.14 | LDD0393 | [1] | |
C-Sul Probe Info |
![]() |
51.12 | LDD0066 | [2] | |
AMP probe Probe Info |
![]() |
K15(0.00); K18(0.00) | LDD0200 | [3] | |
ATP probe Probe Info |
![]() |
K15(0.00); K18(0.00); K21(0.00); K103(0.00) | LDD0199 | [3] | |
CY-1 Probe Info |
![]() |
D101(0.00); E96(0.00); K103(0.00); T102(0.00) | LDD0246 | [4] | |
ATP probe Probe Info |
![]() |
K15(0.00); K21(0.00) | LDD0035 | [5] | |
NHS Probe Info |
![]() |
N.A. | LDD0010 | [6] | |
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [6] | |
1c-yne Probe Info |
![]() |
K20(0.00); K15(0.00) | LDD0228 | [7] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
Diazir Probe Info |
![]() |
N.A. | LDD0011 | [6] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Fibroblast growth factor receptor 3 (FGFR3) | Tyr protein kinase family | P22607 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Glutamate receptor ionotropic, NMDA 2C (GRIN2C) | Glutamate-gated ion channel family | Q14957 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Telomeric repeat-binding factor 2-interacting protein 1 (TERF2IP) | RAP1 family | Q9NYB0 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Kelch-like ECH-associated protein 1 (KEAP1) | KEAP1 family | Q14145 | |||
Nuclear protein 1 (NUPR1) | NUPR family | O60356 | |||
Ubiquilin-1 (UBQLN1) | . | Q9UMX0 |
References