Details of the Target
General Information of Target
| Target ID | LDTP01763 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome b5 (CYB5A) | |||||
| Gene Name | CYB5A | |||||
| Gene ID | 1528 | |||||
| Synonyms |
CYB5; Cytochrome b5; Microsomal cytochrome b5 type A; MCB5 |
|||||
| 3D Structure | ||||||
| Sequence |
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA VAVALMYRLYMAED |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Cytochrome b5 family
|
|||||
| Subcellular location |
Cytoplasm; Cytoplasmic side; Endoplasmic reticulum membrane; Single-pass membrane protein
|
|||||
| Function | Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K19(10.00) | LDD0277 | [1] | |
|
HPAP Probe Info |
![]() |
3.15 | LDD0062 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0224 | [3] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [4] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [5] | |
|
FFF probe13 Probe Info |
![]() |
20.00 | LDD0475 | [5] | |
|
FFF probe14 Probe Info |
![]() |
20.00 | LDD0477 | [5] | |
|
FFF probe3 Probe Info |
![]() |
20.00 | LDD0464 | [5] | |
|
A-DA Probe Info |
![]() |
2.17 | LDD0141 | [6] | |
|
OEA-DA Probe Info |
![]() |
20.00 | LDD0046 | [7] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Wolframin (WFS1) | . | O76024 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Progranulin (GRN) | Granulin family | P28799 | |||
| RING finger protein 11 (RNF11) | . | Q9Y3C5 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Chromic Nitrate | . | DB14527 | |||
| Chromium | . | DB11136 | |||
| Chromium Gluconate | . | DB14528 | |||
| Chromium Nicotinate | . | DB14529 | |||
| Chromous Sulfate | . | DB14530 | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Chromic Citrate | . | DB14526 | |||
| Dimethyl Propionate Ester Heme | . | DB04009 | |||
References











