Details of the Target
General Information of Target
Target ID | LDTP01763 | |||||
---|---|---|---|---|---|---|
Target Name | Cytochrome b5 (CYB5A) | |||||
Gene Name | CYB5A | |||||
Gene ID | 1528 | |||||
Synonyms |
CYB5; Cytochrome b5; Microsomal cytochrome b5 type A; MCB5 |
|||||
3D Structure | ||||||
Sequence |
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA VAVALMYRLYMAED |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Cytochrome b5 family
|
|||||
Subcellular location |
Cytoplasm; Cytoplasmic side; Endoplasmic reticulum membrane; Single-pass membrane protein
|
|||||
Function | Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K19(10.00) | LDD0277 | [1] | |
HPAP Probe Info |
![]() |
3.15 | LDD0062 | [2] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0224 | [3] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [4] | |
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [4] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [5] | |
FFF probe13 Probe Info |
![]() |
20.00 | LDD0475 | [5] | |
FFF probe14 Probe Info |
![]() |
20.00 | LDD0477 | [5] | |
FFF probe3 Probe Info |
![]() |
20.00 | LDD0464 | [5] | |
A-DA Probe Info |
![]() |
2.17 | LDD0141 | [6] | |
OEA-DA Probe Info |
![]() |
20.00 | LDD0046 | [7] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Wolframin (WFS1) | . | O76024 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Progranulin (GRN) | Granulin family | P28799 | |||
RING finger protein 11 (RNF11) | . | Q9Y3C5 |
The Drug(s) Related To This Target
Approved
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Chromic Nitrate | . | DB14527 | |||
Chromium | . | DB11136 | |||
Chromium Gluconate | . | DB14528 | |||
Chromium Nicotinate | . | DB14529 | |||
Chromous Sulfate | . | DB14530 |
Investigative
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Chromic Citrate | . | DB14526 | |||
Dimethyl Propionate Ester Heme | . | DB04009 |
References