Details of the Target

General Information of Target

Target ID LDTP00071
Target Name Vacuolar protein sorting-associated protein 37C (VPS37C)
Gene Name VPS37C
Gene ID 55048
Synonyms
PML39; Vacuolar protein sorting-associated protein 37C; hVps37C; ESCRT-I complex subunit VPS37C
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDRYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVR
PVPQGTPPVVEEQPQPPLAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQLGPRGAAGYSWSPQRSMPPRPGYPGTPMGASGPGYPLRGGRAPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
Target Bioclass
Other
Family
VPS37 family
Subcellular location
Late endosome membrane
Function
Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.
Uniprot ID
A5D8V6
Ensemble ID
ENST00000301765.10
HGNC ID
HGNC:26097

Probe(s) Labeling This Target

PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C223
 Probe Info  		6.19  LDD1897  [1]
C225
 Probe Info  		7.46  LDD1898  [1]
C228
 Probe Info  		20.11  LDD1901  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA-directed RNA polymerase II subunit RPB11-a (POLR2J) Archaeal Rpo11/eukaryotic RPB11/RPC19 RNA polymerase subunit family P52435
DNA-directed RNA polymerase II subunit RPB11-b2 (POLR2J3) Archaeal Rpo11/eukaryotic RPB11/RPC19 RNA polymerase subunit family Q9H1A7
Baculoviral IAP repeat-containing protein 7 (BIRC7) IAP family Q96CA5
E3 ubiquitin-protein ligase XIAP (XIAP) IAP family P98170
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Prolyl 4-hydroxylase subunit alpha-3 (P4HA3) P4HA family Q7Z4N8
Inactive Ufm1-specific protease 1 (UFSP1) Peptidase C78 family Q6NVU6
Proteasome subunit alpha type-3 (PSMA3) Peptidase T1A family P25788
Group 10 secretory phospholipase A2 (PLA2G10) Phospholipase A2 family O15496
Phospholipid scramblase 1 (PLSCR1) Phospholipid scramblase family O15162
E3 ubiquitin-protein ligase SH3RF2 (SH3RF2) SH3RF family Q8TEC5
Tumor susceptibility gene 101 protein (TSG101) Ubiquitin-conjugating enzyme family Q99816
Methyltransferase-like protein 27 (METTL27) . Q8N6F8
NEDD4-like E3 ubiquitin-protein ligase WWP2 (WWP2) . O00308
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
Programmed cell death protein 6 (PDCD6) . O75340
Transcription factor
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
DNA damage-inducible transcript 3 protein (DDIT3) BZIP family P35638
Krueppel-like factor 1 (KLF1) Krueppel C2H2-type zinc-finger protein family Q13351
Cone-rod homeobox protein (CRX) Paired homeobox family O43186
POU domain class 2-associating factor 1 (POU2AF1) POU2AF family Q16633
DNA-binding protein RFX6 (RFX6) RFX family Q8HWS3
Homeobox protein PKNOX1 (PKNOX1) TALE/MEIS homeobox family P55347
Homeobox protein PKNOX2 (PKNOX2) TALE/MEIS homeobox family Q96KN3
Achaete-scute homolog 3 (ASCL3) . Q9NQ33
Paired box protein Pax-9 (PAX9) . P55771
Other
Click To Hide/Show 47 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
EKC/KEOPS complex subunit LAGE3 (LAGE3) CTAG/PCC1 family Q14657
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Endophilin-A2 (SH3GL1) Endophilin family Q99961
Protein FAM168A (FAM168A) FAM168 family Q92567
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Keratin-associated protein 7-1 (KRTAP7-1) KRTAP type 7 family Q8IUC3
MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L) MISS family Q8NDC0
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
Proline-rich protein 20D (PRR20D) PRR20 family P86480
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
RIB43A-like with coiled-coils protein 1 (RIBC1) RIB43A family Q8N443
RAD50-interacting protein 1 (RINT1) RINT1 family Q6NUQ1
Signal transducing adapter molecule 2 (STAM2) STAM family O75886
Transforming acidic coiled-coil-containing protein 3 (TACC3) TACC family Q9Y6A5
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Regulation of nuclear pre-mRNA domain-containing protein 1B (RPRD1B) UPF0400 (RTT103) family Q9NQG5
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
YTH domain-containing family protein 1 (YTHDF1) YTHDF family Q9BYJ9
Alanine and arginine-rich domain-containing protein (AARD) . Q4LEZ3
BAG family molecular chaperone regulator 4 (BAG4) . O95429
Centrosomal protein of 55 kDa (CEP55) . Q53EZ4
DAZ-associated protein 2 (DAZAP2) . Q15038
G protein pathway suppressor 2 (GPS2) . Q13227
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Heterogeneous nuclear ribonucleoprotein F (HNRNPF) . P52597
Heterogeneous nuclear ribonucleoprotein U-like protein 1 (HNRNPUL1) . Q9BUJ2
Peflin (PEF1) . Q9UBV8
Protein TFG (TFG) . Q92734
Puratrophin-1 (PLEKHG4) . Q58EX7
RNA-binding protein with multiple splicing (RBPMS) . Q93062
RNA-binding protein with multiple splicing 2 (RBPMS2) . Q6ZRY4
Saitohin (STH) . Q8IWL8
Sorbin and SH3 domain-containing protein 2 (SORBS2) . O94875
Ubiquitin-associated protein 2 (UBAP2) . Q5T6F2
Uncharacterized protein C1orf94 (C1orf94) . Q6P1W5
Vinexin (SORBS3) . O60504
Zinc finger matrin-type protein 5 (ZMAT5) . Q9UDW3
Zinc finger MYND domain-containing protein 12 (ZMYND12) . Q9H0C1

References

1 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587