Details of the Target
General Information of Target
| Target ID | LDTP19326 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative ribosomal protein eL39-like 5 (RPL39P5) | |||||
| Gene Name | RPL39P5 | |||||
| Synonyms |
Putative ribosomal protein eL39-like 5; 60S ribosomal protein L39 pseudogene 5; Putative 60S ribosomal protein L39-like 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MWILSNLMGTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPV
GPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Eukaryotic ribosomal protein eL39 family
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
P1 Probe Info |
![]() |
1.77 | LDD0448 | [1] | |
|
AF-2 Probe Info |
![]() |
2.29 | LDD0422 | [2] | |
|
Ox-W18 Probe Info |
![]() |
N.A. | LDD2175 | [3] | |
Competitor(s) Related to This Target
References



