Details of the Target
General Information of Target
Target ID | LDTP17377 | |||||
---|---|---|---|---|---|---|
Target Name | Tumor necrosis factor alpha-induced protein 8-like protein 2 (TNFAIP8L2) | |||||
Gene Name | TNFAIP8L2 | |||||
Gene ID | 79626 | |||||
Synonyms |
Tumor necrosis factor alpha-induced protein 8-like protein 2; TIPE2; TNF alpha-induced protein 8-like protein 2; TNFAIP8-like protein 2; Inflammation factor protein 20 |
|||||
3D Structure | ||||||
Sequence |
MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVS
ILQLVQNLMHGDEDEEPQSPRIQNIGEQGHVAVLGHSLGAYILTLDEEKLRKLTTRILSD TTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSQYEDFVVDGFSGLYNKKPVIYLSA AARPGLGQYLCNQLGLPFPCLCRVPCNTMFGSQHQMDVAFLEKLIKDDIERGRLPLLLVA NAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSVLAAAKCDSMTMTPG PWLGLPAVPAVTLYKHDPALTLVAGLISNKPTDKLRALPLWLSLQYLGLDGFVERIKHAC QLSQWLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSAVGRE RHSCDALNLWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAGMIS |
|||||
Target Bioclass |
Other
|
|||||
Family |
TNFAIP8 family, TNFAIP8L2 subfamily
|
|||||
Function |
Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Plays a regulatory role in the Toll-like signaling pathway by determining the strength of LPS-induced signaling and gene expression. Inhibits TCR-mediated T-cell activation and negatively regulate T-cell function to prevent hyperresponsiveness. Inhibits also autolysosome formation via negatively modulating MTOR activation by interacting with RAC1 and promoting the disassociation of the RAC1-MTOR complex. Plays an essential role in NK-cell biology by acting as a checkpoint and displaying an expression pattern correlating with NK-cell maturation process and by negatively regulating NK-cell maturation and antitumor immunity. Mechanistically, suppresses IL-15-triggered mTOR activity in NK-cells.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
P3 Probe Info |
![]() |
10.00 | LDD0450 | [1] | |
STPyne Probe Info |
![]() |
K65(1.48) | LDD0277 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C172(0.99) | LDD2187 | [4] |
LDCM0572 | Fragment10 | Ramos | C172(1.06) | LDD2189 | [4] |
LDCM0573 | Fragment11 | Ramos | C172(0.15) | LDD2190 | [4] |
LDCM0574 | Fragment12 | Ramos | C172(1.26) | LDD2191 | [4] |
LDCM0575 | Fragment13 | Ramos | C172(0.93) | LDD2192 | [4] |
LDCM0576 | Fragment14 | Ramos | C172(1.20) | LDD2193 | [4] |
LDCM0579 | Fragment20 | Ramos | C172(1.30) | LDD2194 | [4] |
LDCM0580 | Fragment21 | Ramos | C172(1.04) | LDD2195 | [4] |
LDCM0582 | Fragment23 | Ramos | C172(3.53) | LDD2196 | [4] |
LDCM0578 | Fragment27 | Ramos | C172(0.70) | LDD2197 | [4] |
LDCM0586 | Fragment28 | Ramos | C172(0.88) | LDD2198 | [4] |
LDCM0588 | Fragment30 | Ramos | C172(0.99) | LDD2199 | [4] |
LDCM0589 | Fragment31 | Ramos | C172(0.89) | LDD2200 | [4] |
LDCM0590 | Fragment32 | Ramos | C172(0.81) | LDD2201 | [4] |
LDCM0468 | Fragment33 | Ramos | C172(0.91) | LDD2202 | [4] |
LDCM0596 | Fragment38 | Ramos | C172(1.10) | LDD2203 | [4] |
LDCM0566 | Fragment4 | Ramos | C172(1.34) | LDD2184 | [4] |
LDCM0610 | Fragment52 | Ramos | C172(1.28) | LDD2204 | [4] |
LDCM0614 | Fragment56 | Ramos | C172(1.24) | LDD2205 | [4] |
LDCM0569 | Fragment7 | Ramos | C172(1.74) | LDD2186 | [4] |
LDCM0022 | KB02 | Ramos | C172(4.03) | LDD2182 | [4] |
LDCM0023 | KB03 | Ramos | C172(2.73) | LDD2183 | [4] |
The Interaction Atlas With This Target
References