Details of the Target
General Information of Target
| Target ID | LDTP15944 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome c oxidase assembly factor 1 homolog (COA1) | |||||
| Gene Name | COA1 | |||||
| Gene ID | 55744 | |||||
| Synonyms |
C7orf44; MITRAC15; Cytochrome c oxidase assembly factor 1 homolog; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15 kDa |
|||||
| 3D Structure | ||||||
| Sequence |
MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRREFFTTTTKEGYDRRPVDITPLEQRKLT
FDTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLD AIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDM FTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVF TCLAIALGFYRFWK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
COA1 family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for assembly of mitochondrial respiratory chain complex I and complex IV. As part of the MCIA complex, required for efficient assembly of the mitochondrial complex I.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
W1 Probe Info |
 |
D77(0.00); D83(0.00); N80(0.00); R78(0.00) | LDD0236 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C134 Probe Info |
 |
54.19 | LDD1816 | [2] | |
|
C388 Probe Info |
 |
48.84 | LDD2047 | [2] | |
References