Details of the Target
General Information of Target
| Target ID | LDTP15397 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome P450 4X1 (CYP4X1) | |||||
| Gene Name | CYP4X1 | |||||
| Gene ID | 260293 | |||||
| Synonyms |
Cytochrome P450 4X1; EC 1.14.14.-; CYPIVX1 |
|||||
| 3D Structure | ||||||
| Sequence |
MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGT
LRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLLLLALLVLTCLVLALLAVYLS VLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Cytochrome P450 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
A cytochrome P450 monooxygenase that selectively catalyzes the epoxidation of the last double bond of the arachidonoyl moiety of anandamide, potentially modulating endocannabinoid signaling. Has no hydroxylase activity toward various fatty acids, steroids and prostaglandins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C203(0.78) | LDD1492 | [1] | |
|
CY4 Probe Info |
![]() |
N.A. | LDD0247 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0284 | AC24 | HEK-293T | C203(1.03) | LDD1523 | [1] |
| LDCM0293 | AC32 | HEK-293T | C203(0.99) | LDD1532 | [1] |
| LDCM0302 | AC40 | HEK-293T | C203(0.80) | LDD1541 | [1] |
| LDCM0310 | AC48 | HEK-293T | C203(0.99) | LDD1549 | [1] |
| LDCM0319 | AC56 | HEK-293T | C203(0.91) | LDD1558 | [1] |
| LDCM0328 | AC64 | HEK-293T | C203(0.81) | LDD1567 | [1] |
| LDCM0345 | AC8 | HEK-293T | C203(1.13) | LDD1569 | [1] |
| LDCM0275 | AKOS034007705 | HEK-293T | C203(0.76) | LDD1514 | [1] |
| LDCM0390 | CL12 | HEK-293T | C203(1.05) | LDD1594 | [1] |
| LDCM0412 | CL24 | HEK-293T | C203(1.08) | LDD1616 | [1] |
| LDCM0425 | CL36 | HEK-293T | C203(1.05) | LDD1629 | [1] |
| LDCM0438 | CL48 | HEK-293T | C203(1.23) | LDD1642 | [1] |
| LDCM0452 | CL60 | HEK-293T | C203(1.22) | LDD1655 | [1] |
| LDCM0465 | CL72 | HEK-293T | C203(1.26) | LDD1668 | [1] |
| LDCM0478 | CL84 | HEK-293T | C203(1.24) | LDD1681 | [1] |
| LDCM0491 | CL96 | HEK-293T | C203(0.77) | LDD1694 | [1] |
| LDCM0022 | KB02 | HEK-293T | C203(0.78) | LDD1492 | [1] |
| LDCM0023 | KB03 | HEK-293T | C203(0.94) | LDD1497 | [1] |
| LDCM0024 | KB05 | HEK-293T | C203(0.94) | LDD1502 | [1] |
References


