Details of the Target
General Information of Target
Target ID | LDTP14323 | |||||
---|---|---|---|---|---|---|
Target Name | Small ribosomal subunit protein uS2B (RPSA2) | |||||
Gene Name | RPSA2 | |||||
Synonyms |
RPSA; RPSAP58; Small ribosomal subunit protein uS2B; 37 kDa laminin receptor precursor; 37LRP; 37/67 kDa laminin receptor; LRP/LR; 40S ribosomal protein SA; 40S ribosomal protein SA2; 67 kDa laminin receptor; 67LR; Laminin receptor 1; LamR; Laminin-binding protein precursor p40; LBP/p40
|
|||||
3D Structure | ||||||
Sequence |
MEEQQKEGEAEVAEHWFSKWERQCLAEAEQEEQLPPELQEEAAAELAGLKSEKQKLWHLF
QISATAVAQLYKDSGCQQQGLSMWDPFQNAAMAVTSLYKESGDAHQRSFDLGVQVGHQRR IKDVLEWVKKGRSTIRREDLISFLCGKVPPAPPPPRTPRTPPKPPTGVTSQAVATESSSS VDVDLQPFQEAIALHGLSGAMAGISMRSGDSPQDSGVASSGRRKTSFLEDDLNPFDSEEL ALHLDSGGIRKRTSAQCSDGITDSPIQKRNRMV |
|||||
Target Bioclass |
Other
|
|||||
Family |
Universal ribosomal protein uS2 family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. Acts as a PPP1R16B-dependent substrate of PPP1CA. {|HAMAP-Rule:MF_03016}.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
P8 Probe Info |
![]() |
10.00 | LDD0451 | [1] | |
DBIA Probe Info |
![]() |
C163(2.78) | LDD3311 | [2] | |
NAIA_5 Probe Info |
![]() |
C148(0.00); C163(0.00) | LDD2224 | [3] | |
MPP-AC Probe Info |
![]() |
N.A. | LDD0428 | [4] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STS-1 Probe Info |
![]() |
N.A. | LDD0069 | [5] |
Competitor(s) Related to This Target
References