Details of the Target

General Information of Target

Target ID LDTP13786
Target Name TRAF3-interacting JNK-activating modulator (TRAF3IP3)
Gene Name TRAF3IP3
Gene ID 80342
Synonyms
T3JAM; TRAF3-interacting JNK-activating modulator; TRAF3-interacting protein 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGR
LTRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDI
RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTA
GMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI
EDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIAYEVPKTVSFASSQQEEVAKN
LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNRLLGKQTGLTP
DMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP
IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASH
ADLHRLKYQCFKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPL
RDIQQEAFRASHTHWRGVSFVYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAA
LWMEEGLPAQNAPGTL
Target Bioclass
Other
Subcellular location
Cell membrane
Function
Adapter protein that plays essential roles in both innate and adaptive immunity. Plays a crucial role in the regulation of thymocyte development. Mechanistically, mediates TCR-stimulated activation through recruiting MAP2K1/MEK1 to the Golgi and, thereby, facilitating the interaction of MAP2K1/MEK1 with its activator BRAF. Also plays an essential role in regulatory T-cell stability and function by recruiting the serine-threonine phosphatase catalytic subunit (PPP2CA) to the lysosome, thereby facilitating the interaction of PP2Ac with the mTORC1 component RPTOR and restricting glycolytic metabolism. Positively regulates TLR4 signaling activity in macrophage-mediated inflammation by acting as a molecular clamp to facilitate LPS-induced translocation of TLR4 to lipid rafts. In response to viral infection, facilitates the recruitment of TRAF3 to MAVS within mitochondria leading to IRF3 activation and interferon production. However, participates in the maintenance of immune homeostasis and the prevention of overzealous innate immunity by promoting 'Lys-48'-dependent ubiquitination of TBK1.
Uniprot ID
Q9Y228
Ensemble ID
ENST00000367024.5
HGNC ID
HGNC:30766

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A204 SNV: p.C35F DBIA    Probe Info 
CAL148 SNV: p.S132Ter .
HCC1395 SNV: p.W15Ter .
HCT116 SNV: p.G46R .
HDMYZ SNV: p.D463Y .
KMCH1 SNV: p.T183N; p.Q196Ter .
MEWO SNV: p.S248F .
MOLT4 SNV: p.W527Ter IA-alkyne    Probe Info 
TE4 Deletion: p.K212TfsTer18
SNV: p.L211V		 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C380(1.56)  LDD3333  [1]
Johansson_61
 Probe Info  		_(11.11)  LDD1485  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [3]
IA-alkyne
 Probe Info  		C501(0.00); C256(0.00); C388(0.00); C380(0.00)  LDD0036  [3]
Lodoacetamide azide
 Probe Info  		C501(0.00); C256(0.00)  LDD0037  [3]
Compound 10
 Probe Info  		C105(0.00); C135(0.00); C256(0.00); C380(0.00)  LDD2216  [4]
Compound 11
 Probe Info  		N.A.  LDD2213  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0616  Fragment61 Jurkat _(10.50)  LDD1489  [2]
 LDCM0569  Fragment7 Jurkat _(11.11)  LDD1485  [2]
 LDCM0022  KB02 T cell C256(5.17)  LDD1703  [5]
 LDCM0023  KB03 697 C380(1.71)  LDD2662  [1]
 LDCM0024  KB05 MOLM-13 C380(1.56)  LDD3333  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA) AGC Ser/Thr protein kinase family P17612
Serine/threonine-protein kinase 24 (STK24) STE Ser/Thr protein kinase family Q9Y6E0
TGF-beta receptor type-2 (TGFBR2) TKL Ser/Thr protein kinase family P37173
E3 ubiquitin-protein ligase TRIM36 (TRIM36) TRIM/RBCC family Q9NQ86
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Syntaxin-1A (STX1A) Syntaxin family Q16623
Syntaxin-4 (STX4) Syntaxin family Q12846
Transmembrane protein 139 (TMEM139) . Q8IV31
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) BZIP family Q68CJ9
Nuclear autoantigen Sp-100 (SP100) . P23497
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
Other
Click To Hide/Show 34 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Coiled-coil domain-containing protein 88B (CCDC88B) CCDC88 family A6NC98
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Ubiquinone biosynthesis protein COQ9, mitochondrial (COQ9) COQ9 family O75208
Cyclin-C (CCNC) Cyclin family P24863
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Major intrinsically disordered Notch2-binding receptor 1 (MINAR1) MINAR family Q9UPX6
MOB-like protein phocein (MOB4) MOB1/phocein family Q9Y3A3
NACHT, LRR and PYD domains-containing protein 12 (NLRP12) NLRP family P59046
Nuclear distribution protein nudE-like 1 (NDEL1) NudE family Q9GZM8
Oxysterol-binding protein-related protein 3 (OSBPL3) OSBP family Q9H4L5
UV excision repair protein RAD23 homolog A (RAD23A) RAD23 family P54725
Suppressor of IKBKE 1 (SIKE1) SIKE family Q9BRV8
Striatin-interacting protein 1 (STRIP1) STRIP family Q5VSL9
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Striatin (STRN) WD repeat striatin family O43815
Striatin-3 (STRN3) WD repeat striatin family Q13033
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Chromobox protein homolog 5 (CBX5) . P45973
Emerin (EMD) . P50402
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
GRAM domain-containing protein 2A (GRAMD2A) . Q8IUY3
Lck-interacting transmembrane adapter 1 (LIME1) . Q9H400
Leucine-rich repeat-containing protein 25 (LRRC25) . Q8N386
Pleckstrin homology domain-containing family O member 1 (PLEKHO1) . Q53GL0
Proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1) . O43586
Protein KASH5 (KASH5) . Q8N6L0
Protein ZNRD2 (ZNRD2) . O60232
Rac GTPase-activating protein 1 (RACGAP1) . Q9H0H5
Receptor-binding cancer antigen expressed on SiSo cells (EBAG9) . O00559
WW domain-containing adapter protein with coiled-coil (WAC) . Q9BTA9

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
5 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.