Details of the Target
General Information of Target
| Target ID | LDTP13786 | |||||
|---|---|---|---|---|---|---|
| Target Name | TRAF3-interacting JNK-activating modulator (TRAF3IP3) | |||||
| Gene Name | TRAF3IP3 | |||||
| Gene ID | 80342 | |||||
| Synonyms |
T3JAM; TRAF3-interacting JNK-activating modulator; TRAF3-interacting protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGR
LTRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDI RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTA GMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI EDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIAYEVPKTVSFASSQQEEVAKN LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNRLLGKQTGLTP DMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASH ADLHRLKYQCFKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPL RDIQQEAFRASHTHWRGVSFVYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAA LWMEEGLPAQNAPGTL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Adapter protein that plays essential roles in both innate and adaptive immunity. Plays a crucial role in the regulation of thymocyte development. Mechanistically, mediates TCR-stimulated activation through recruiting MAP2K1/MEK1 to the Golgi and, thereby, facilitating the interaction of MAP2K1/MEK1 with its activator BRAF. Also plays an essential role in regulatory T-cell stability and function by recruiting the serine-threonine phosphatase catalytic subunit (PPP2CA) to the lysosome, thereby facilitating the interaction of PP2Ac with the mTORC1 component RPTOR and restricting glycolytic metabolism. Positively regulates TLR4 signaling activity in macrophage-mediated inflammation by acting as a molecular clamp to facilitate LPS-induced translocation of TLR4 to lipid rafts. In response to viral infection, facilitates the recruitment of TRAF3 to MAVS within mitochondria leading to IRF3 activation and interferon production. However, participates in the maintenance of immune homeostasis and the prevention of overzealous innate immunity by promoting 'Lys-48'-dependent ubiquitination of TBK1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A204 | SNV: p.C35F | DBIA Probe Info | |||
| CAL148 | SNV: p.S132Ter | . | |||
| HCC1395 | SNV: p.W15Ter | . | |||
| HCT116 | SNV: p.G46R | . | |||
| HDMYZ | SNV: p.D463Y | . | |||
| KMCH1 | SNV: p.T183N; p.Q196Ter | . | |||
| MEWO | SNV: p.S248F | . | |||
| MOLT4 | SNV: p.W527Ter | IA-alkyne Probe Info | |||
| TE4 | Deletion: p.K212TfsTer18 SNV: p.L211V |
. | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C380(1.56) | LDD3333 | [1] | |
|
Johansson_61 Probe Info |
![]() |
_(11.11) | LDD1485 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C501(0.00); C256(0.00); C388(0.00); C380(0.00) | LDD0036 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
C501(0.00); C256(0.00) | LDD0037 | [3] | |
|
Compound 10 Probe Info |
![]() |
C105(0.00); C135(0.00); C256(0.00); C380(0.00) | LDD2216 | [4] | |
|
Compound 11 Probe Info |
![]() |
N.A. | LDD2213 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Syntaxin-1A (STX1A) | Syntaxin family | Q16623 | |||
| Syntaxin-4 (STX4) | Syntaxin family | Q12846 | |||
| Transmembrane protein 139 (TMEM139) | . | Q8IV31 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) | BZIP family | Q68CJ9 | |||
| Nuclear autoantigen Sp-100 (SP100) | . | P23497 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) | Immunoglobulin superfamily | P43628 | |||
Other
References







