Details of the Target
General Information of Target
Target ID | LDTP13398 | |||||
---|---|---|---|---|---|---|
Target Name | Forkhead box protein D3 (FOXD3) | |||||
Gene Name | FOXD3 | |||||
Gene ID | 27022 | |||||
Synonyms |
HFH2; Forkhead box protein D3; HNF3/FH transcription factor genesis |
|||||
3D Structure | ||||||
Sequence |
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM QLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI |
|||||
Target Bioclass |
Transcription factor
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. Also acts as a transcriptional activator. Negatively regulates transcription of transcriptional repressor RHIT/ZNF205. Promotes development of neural crest cells from neural tube progenitors. Restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. Required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
HPAP Probe Info |
![]() |
3.24 | LDD0062 | [1] | |
DBIA Probe Info |
![]() |
C104(1.01) | LDD1492 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0259 | AC14 | HEK-293T | C104(1.03) | LDD1512 | [2] |
LDCM0282 | AC22 | HEK-293T | C104(1.02) | LDD1521 | [2] |
LDCM0291 | AC30 | HEK-293T | C104(1.16) | LDD1530 | [2] |
LDCM0299 | AC38 | HEK-293T | C104(0.88) | LDD1538 | [2] |
LDCM0308 | AC46 | HEK-293T | C104(1.04) | LDD1547 | [2] |
LDCM0317 | AC54 | HEK-293T | C104(1.28) | LDD1556 | [2] |
LDCM0323 | AC6 | HEK-293T | C104(0.97) | LDD1562 | [2] |
LDCM0326 | AC62 | HEK-293T | C104(1.02) | LDD1565 | [2] |
LDCM0368 | CL10 | HEK-293T | C104(0.88) | LDD1572 | [2] |
LDCM0410 | CL22 | HEK-293T | C104(1.18) | LDD1614 | [2] |
LDCM0423 | CL34 | HEK-293T | C104(1.18) | LDD1627 | [2] |
LDCM0436 | CL46 | HEK-293T | C104(1.58) | LDD1640 | [2] |
LDCM0449 | CL58 | HEK-293T | C104(1.47) | LDD1652 | [2] |
LDCM0463 | CL70 | HEK-293T | C104(1.12) | LDD1666 | [2] |
LDCM0476 | CL82 | HEK-293T | C104(1.13) | LDD1679 | [2] |
LDCM0489 | CL94 | HEK-293T | C104(1.12) | LDD1692 | [2] |
LDCM0022 | KB02 | HEK-293T | C104(1.01) | LDD1492 | [2] |
LDCM0023 | KB03 | HEK-293T | C104(1.03) | LDD1497 | [2] |
LDCM0024 | KB05 | HEK-293T | C104(0.99) | LDD1502 | [2] |
LDCM0014 | Panhematin | HEK-293T | 3.24 | LDD0062 | [1] |
The Interaction Atlas With This Target
References