Details of the Target
General Information of Target
| Target ID | LDTP13281 | |||||
|---|---|---|---|---|---|---|
| Target Name | ProSAAS (PCSK1N) | |||||
| Gene Name | PCSK1N | |||||
| Gene ID | 27344 | |||||
| Synonyms |
ProSAAS; Proprotein convertase subtilisin/kexin type 1 inhibitor; Proprotein convertase 1 inhibitor; pro-SAAS) [Cleaved into: KEP; Big SAAS; b-SAAS; Little SAAS; l-SAAS; N-proSAAS; Big PEN-LEN; b-PEN-LEN; SAAS CT(1-49); PEN; Little LEN; l-LEN; Big LEN; b-LEN; SAAS CT(25-40))]
|
|||||
| 3D Structure | ||||||
| Sequence |
MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFG
AVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQEAFKKLNYLDIGEIKKRPMEVVNTEVKPV IHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLR SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKASS LPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS QETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDA EQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVN NELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity.; [Big LEN]: Endogenous ligand for GPR171. Neuropeptide involved in the regulation of feeding.; [PEN]: Endogenous ligand for GPR171. Neuropeptide involved in the regulation of feeding.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
![]() |
2.88 | LDD0054 | [1] | |
Competitor(s) Related to This Target

