Details of the Target

General Information of Target

Target ID LDTP11123
Target Name MICOS complex subunit MIC25 (CHCHD6)
Gene Name CHCHD6
Gene ID 84303
Synonyms
CHCM1; MIC25; MICOS complex subunit MIC25; Coiled-coil-helix cristae morphology protein 1; Coiled-coil-helix-coiled-coil-helix domain-containing protein 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPK
FRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADP
LGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVH
ELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLS
GGPEAHESTGIFFVETQNVQRLLETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALL
PPL
Target Bioclass
Other
Family
MICOS complex subunit Mic19 family, Metazoan Mic25 subfamily
Subcellular location
Mitochondrion inner membrane
Function
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
Uniprot ID
Q9BRQ6
Ensemble ID
ENST00000290913.8
HGNC ID
HGNC:28184
ChEMBL ID
CHEMBL4105993

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K114(9.09); K133(5.92)  LDD0277  [1]
BTD
 Probe Info  		C228(0.58)  LDD2104  [2]
DBIA
 Probe Info  		C218(1.04)  LDD1492  [3]
5E-2FA
 Probe Info  		H64(0.00); H213(0.00); H178(0.00); H206(0.00)  LDD2235  [4]
m-APA
 Probe Info  		H64(0.00); H129(0.00); H94(0.00); H206(0.00)  LDD2231  [4]
IA-alkyne
 Probe Info  		C228(0.00); C197(0.00)  LDD0162  [5]
IPM
 Probe Info  		N.A.  LDD2156  [6]
NAIA_5
 Probe Info  		C228(0.00); C218(0.00)  LDD2223  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C218(1.10)  LDD1512  [3]
 LDCM0281  AC21 HEK-293T C218(1.01)  LDD1520  [3]
 LDCM0282  AC22 HEK-293T C218(1.05)  LDD1521  [3]
 LDCM0284  AC24 HEK-293T C218(0.96)  LDD1523  [3]
 LDCM0289  AC29 HEK-293T C218(1.03)  LDD1528  [3]
 LDCM0291  AC30 HEK-293T C218(0.97)  LDD1530  [3]
 LDCM0293  AC32 HEK-293T C218(1.06)  LDD1532  [3]
 LDCM0298  AC37 HEK-293T C218(1.11)  LDD1537  [3]
 LDCM0299  AC38 HEK-293T C218(0.94)  LDD1538  [3]
 LDCM0302  AC40 HEK-293T C218(0.98)  LDD1541  [3]
 LDCM0307  AC45 HEK-293T C218(1.00)  LDD1546  [3]
 LDCM0308  AC46 HEK-293T C218(1.14)  LDD1547  [3]
 LDCM0310  AC48 HEK-293T C218(0.96)  LDD1549  [3]
 LDCM0312  AC5 HEK-293T C218(1.14)  LDD1551  [3]
 LDCM0316  AC53 HEK-293T C218(1.13)  LDD1555  [3]
 LDCM0317  AC54 HEK-293T C218(0.98)  LDD1556  [3]
 LDCM0319  AC56 HEK-293T C218(1.05)  LDD1558  [3]
 LDCM0323  AC6 HEK-293T C218(0.98)  LDD1562  [3]
 LDCM0325  AC61 HEK-293T C218(1.15)  LDD1564  [3]
 LDCM0326  AC62 HEK-293T C218(1.00)  LDD1565  [3]
 LDCM0328  AC64 HEK-293T C218(1.11)  LDD1567  [3]
 LDCM0345  AC8 HEK-293T C218(1.12)  LDD1569  [3]
 LDCM0248  AKOS034007472 HEK-293T C218(1.12)  LDD1511  [3]
 LDCM0275  AKOS034007705 HEK-293T C218(0.98)  LDD1514  [3]
 LDCM0020  ARS-1620 HCC44 C197(0.96); C207(0.96)  LDD2171  [8]
 LDCM0368  CL10 HEK-293T C218(0.86)  LDD1572  [3]
 LDCM0390  CL12 HEK-293T C218(0.83)  LDD1594  [3]
 LDCM0409  CL21 HEK-293T C218(0.94)  LDD1613  [3]
 LDCM0410  CL22 HEK-293T C218(0.89)  LDD1614  [3]
 LDCM0412  CL24 HEK-293T C218(0.81)  LDD1616  [3]
 LDCM0422  CL33 HEK-293T C218(0.91)  LDD1626  [3]
 LDCM0423  CL34 HEK-293T C218(0.92)  LDD1627  [3]
 LDCM0425  CL36 HEK-293T C218(0.82)  LDD1629  [3]
 LDCM0435  CL45 HEK-293T C218(1.06)  LDD1639  [3]
 LDCM0436  CL46 HEK-293T C218(0.92)  LDD1640  [3]
 LDCM0438  CL48 HEK-293T C218(0.85)  LDD1642  [3]
 LDCM0448  CL57 HEK-293T C218(0.94)  LDD1651  [3]
 LDCM0449  CL58 HEK-293T C218(0.94)  LDD1652  [3]
 LDCM0452  CL60 HEK-293T C218(0.88)  LDD1655  [3]
 LDCM0461  CL69 HEK-293T C218(1.06)  LDD1664  [3]
 LDCM0463  CL70 HEK-293T C218(0.96)  LDD1666  [3]
 LDCM0465  CL72 HEK-293T C218(0.81)  LDD1668  [3]
 LDCM0475  CL81 HEK-293T C218(1.18)  LDD1678  [3]
 LDCM0476  CL82 HEK-293T C218(0.90)  LDD1679  [3]
 LDCM0478  CL84 HEK-293T C218(0.85)  LDD1681  [3]
 LDCM0484  CL9 HEK-293T C218(1.08)  LDD1687  [3]
 LDCM0488  CL93 HEK-293T C218(1.06)  LDD1691  [3]
 LDCM0489  CL94 HEK-293T C218(0.88)  LDD1692  [3]
 LDCM0491  CL96 HEK-293T C218(0.98)  LDD1694  [3]
 LDCM0022  KB02 HEK-293T C218(1.04)  LDD1492  [3]
 LDCM0023  KB03 HEK-293T C218(1.05)  LDD1497  [3]
 LDCM0024  KB05 HEK-293T C218(0.99)  LDD1502  [3]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C228(0.58)  LDD2104  [2]
 LDCM0021  THZ1 HCT 116 C197(0.96); C207(0.96)  LDD2173  [8]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sorting and assembly machinery component 50 homolog (SAMM50) SAM50/omp85 family Q9Y512

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
6 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
7 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
8 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.