Details of the Target
General Information of Target
| Target ID | LDTP10104 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interferon-stimulated gene 20 kDa protein (ISG20) | |||||
| Gene Name | ISG20 | |||||
| Gene ID | 3669 | |||||
| Synonyms |
HEM45; Interferon-stimulated gene 20 kDa protein; EC 3.1.13.1; Estrogen-regulated transcript 45 protein; Promyelocytic leukemia nuclear body-associated protein ISG20 |
|||||
| 3D Structure | ||||||
| Sequence |
MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAA
LSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANV PAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLAS KMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Exonuclease superfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Interferon-induced antiviral exoribonuclease that acts mainly on single-stranded RNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV). Inhibition of several viruses such as chikungunya virus (CHIKV) does not involve the degradation of viral RNAs, but rather the inhibition of translation of viral proteins. Exerts a translational control over a large panel of non-self RNA substrates while sparing endogenous transcripts. This activity correlates with the protein's ability to localize in cytoplasmic processing bodies. May also act as master regulator of over hundred interferon stimulated genes leading to viral genome translation inhibition. May play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
 |
Y108(15.51); Y162(6.47) | LDD3495 | [1] | |
|
EA-probe Probe Info |
 |
N.A. | LDD0440 | [2] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0162 | [3] | |
|
NAIA_5 Probe Info |
 |
C28(0.00); C12(0.00) | LDD2223 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0175 | Ethacrynic acid | HeLa | N.A. | LDD0440 | [2] |
| LDCM0625 | F8 | Ramos | C12(0.49) | LDD2187 | [5] |
| LDCM0572 | Fragment10 | Ramos | C12(0.52) | LDD2189 | [5] |
| LDCM0573 | Fragment11 | Ramos | C12(0.62) | LDD2190 | [5] |
| LDCM0574 | Fragment12 | Ramos | C12(2.83) | LDD2191 | [5] |
| LDCM0576 | Fragment14 | Ramos | C12(0.70) | LDD2193 | [5] |
| LDCM0586 | Fragment28 | Ramos | C12(1.04) | LDD2198 | [5] |
| LDCM0588 | Fragment30 | Ramos | C12(0.64) | LDD2199 | [5] |
| LDCM0590 | Fragment32 | Ramos | C12(0.57) | LDD2201 | [5] |
| LDCM0468 | Fragment33 | Ramos | C12(0.74) | LDD2202 | [5] |
| LDCM0596 | Fragment38 | Ramos | C12(0.70) | LDD2203 | [5] |
| LDCM0566 | Fragment4 | Ramos | C12(0.72) | LDD2184 | [5] |
| LDCM0610 | Fragment52 | Ramos | C12(0.72) | LDD2204 | [5] |
| LDCM0569 | Fragment7 | Ramos | C12(0.46) | LDD2186 | [5] |
| LDCM0022 | KB02 | Ramos | C12(0.37) | LDD2182 | [5] |
| LDCM0023 | KB03 | Ramos | C12(0.53) | LDD2183 | [5] |
| LDCM0024 | KB05 | Ramos | C12(0.30) | LDD2185 | [5] |
The Interaction Atlas With This Target
References