Details of the Target

General Information of Target

Target ID LDTP10034
Target Name F-box/WD repeat-containing protein 5 (FBXW5)
Gene Name FBXW5
Gene ID 54461
Synonyms
FBW5; F-box/WD repeat-containing protein 5; F-box and WD-40 domain-containing protein 5
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFL
SKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAI
EFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFY
PGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNV
YMPTSQPPPPPYYPPEDKKTQ
Target Bioclass
Other
Family
FBXW5 family
Subcellular location
Cytoplasm
Function
Substrate recognition component of both SCF (SKP1-CUL1-F-box protein) and DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes. Substrate recognition component of the SCF(FBXW5) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SASS6 during S phase, leading to prevent centriole reduplication. The SCF(FBXW5) complex also mediates ubiquitination and degradation of actin-regulator EPS8 during G2 phase, leading to the transient degradation of EPS8 and subsequent cell shape changes required to allow mitotic progression. Substrate-specific adapter of the DCX(FBXW5) E3 ubiquitin-protein ligase complex which mediates the polyubiquitination and subsequent degradation of TSC2. May also act as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B (IL1B) signaling pathway.
Uniprot ID
Q969U6
Ensemble ID
ENST00000325285.8
HGNC ID
HGNC:13613

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HT SNV: p.V249D .
NCIH1155 SNV: p.C110Y .
SNU1 SNV: p.Y494H .
SNU449 SNV: p.G270C .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K240(1.54)  LDD0277  [1]
DBIA
 Probe Info  		C503(3.09)  LDD3470  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0285  AC25 PaTu 8988t C277(1.11)  LDD1164  [4]
 LDCM0286  AC26 PaTu 8988t C277(0.99)  LDD1165  [4]
 LDCM0287  AC27 PaTu 8988t C277(1.32)  LDD1166  [4]
 LDCM0288  AC28 PaTu 8988t C277(1.22)  LDD1167  [4]
 LDCM0289  AC29 PaTu 8988t C277(1.48)  LDD1168  [4]
 LDCM0291  AC30 PaTu 8988t C277(1.24)  LDD1170  [4]
 LDCM0292  AC31 PaTu 8988t C277(1.78)  LDD1171  [4]
 LDCM0293  AC32 PaTu 8988t C277(0.97)  LDD1172  [4]
 LDCM0294  AC33 PaTu 8988t C277(1.04)  LDD1173  [4]
 LDCM0295  AC34 PaTu 8988t C277(1.28)  LDD1174  [4]
 LDCM0382  CL112 PaTu 8988t C277(1.17)  LDD1261  [4]
 LDCM0383  CL113 PaTu 8988t C277(1.23)  LDD1262  [4]
 LDCM0384  CL114 PaTu 8988t C277(0.92)  LDD1263  [4]
 LDCM0385  CL115 PaTu 8988t C277(1.07)  LDD1264  [4]
 LDCM0386  CL116 PaTu 8988t C277(1.23)  LDD1265  [4]
 LDCM0420  CL31 PaTu 8988t C277(1.05)  LDD1299  [4]
 LDCM0421  CL32 PaTu 8988t C277(1.65)  LDD1300  [4]
 LDCM0422  CL33 PaTu 8988t C277(1.61)  LDD1301  [4]
 LDCM0423  CL34 PaTu 8988t C277(1.49)  LDD1302  [4]
 LDCM0424  CL35 PaTu 8988t C277(1.36)  LDD1303  [4]
 LDCM0425  CL36 PaTu 8988t C277(1.34)  LDD1304  [4]
 LDCM0426  CL37 PaTu 8988t C277(1.64)  LDD1305  [4]
 LDCM0428  CL39 PaTu 8988t C277(1.85)  LDD1307  [4]
 LDCM0430  CL40 PaTu 8988t C277(1.06)  LDD1309  [4]
 LDCM0431  CL41 PaTu 8988t C277(2.04)  LDD1310  [4]
 LDCM0432  CL42 PaTu 8988t C277(1.80)  LDD1311  [4]
 LDCM0433  CL43 PaTu 8988t C277(2.12)  LDD1312  [4]
 LDCM0434  CL44 PaTu 8988t C277(1.81)  LDD1313  [4]
 LDCM0435  CL45 PaTu 8988t C277(1.55)  LDD1314  [4]
 LDCM0436  CL46 PaTu 8988t C277(1.23)  LDD1315  [4]
 LDCM0437  CL47 PaTu 8988t C277(0.98)  LDD1316  [4]
 LDCM0438  CL48 PaTu 8988t C277(1.05)  LDD1317  [4]
 LDCM0439  CL49 PaTu 8988t C277(1.13)  LDD1318  [4]
 LDCM0441  CL50 PaTu 8988t C277(1.44)  LDD1320  [4]
 LDCM0442  CL51 PaTu 8988t C277(1.02)  LDD1321  [4]
 LDCM0443  CL52 PaTu 8988t C277(1.06)  LDD1322  [4]
 LDCM0444  CL53 PaTu 8988t C277(1.11)  LDD1323  [4]
 LDCM0445  CL54 PaTu 8988t C277(1.60)  LDD1324  [4]
 LDCM0446  CL55 PaTu 8988t C277(0.89)  LDD1325  [4]
 LDCM0447  CL56 PaTu 8988t C277(0.39)  LDD1326  [4]
 LDCM0448  CL57 PaTu 8988t C277(1.63)  LDD1327  [4]
 LDCM0449  CL58 PaTu 8988t C277(1.15)  LDD1328  [4]
 LDCM0450  CL59 PaTu 8988t C277(2.01)  LDD1329  [4]
 LDCM0452  CL60 PaTu 8988t C277(1.29)  LDD1331  [4]
 LDCM0469  CL76 PaTu 8988t C277(1.11)  LDD1348  [4]
 LDCM0470  CL77 PaTu 8988t C277(0.80)  LDD1349  [4]
 LDCM0471  CL78 PaTu 8988t C277(1.08)  LDD1350  [4]
 LDCM0472  CL79 PaTu 8988t C277(1.01)  LDD1351  [4]
 LDCM0474  CL80 PaTu 8988t C277(1.04)  LDD1353  [4]
 LDCM0475  CL81 PaTu 8988t C277(1.34)  LDD1354  [4]
 LDCM0476  CL82 PaTu 8988t C277(1.11)  LDD1355  [4]
 LDCM0477  CL83 PaTu 8988t C277(1.03)  LDD1356  [4]
 LDCM0478  CL84 PaTu 8988t C277(1.13)  LDD1357  [4]
 LDCM0479  CL85 PaTu 8988t C277(1.07)  LDD1358  [4]
 LDCM0480  CL86 PaTu 8988t C277(0.95)  LDD1359  [4]
 LDCM0481  CL87 PaTu 8988t C277(1.13)  LDD1360  [4]
 LDCM0482  CL88 PaTu 8988t C277(0.98)  LDD1361  [4]
 LDCM0483  CL89 PaTu 8988t C277(1.01)  LDD1362  [4]
 LDCM0485  CL90 PaTu 8988t C277(1.27)  LDD1364  [4]
 LDCM0427  Fragment51 PaTu 8988t C277(1.73)  LDD1306  [4]
 LDCM0022  KB02 TE-8 C503(2.13)  LDD2636  [2]
 LDCM0023  KB03 TE-8 C503(2.60)  LDD3053  [2]
 LDCM0024  KB05 TE-8 C503(3.09)  LDD3470  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
S-phase kinase-associated protein 1 (SKP1) SKP1 family P63208
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
DNA damage-binding protein 1 (DDB1) DDB1 family Q16531
Epidermal growth factor receptor kinase substrate 8 (EPS8) EPS8 family Q12929
EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2) Fibulin family O95967
Fibulin-2 (FBLN2) Fibulin family P98095
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha7 (KRT37) Intermediate filament family O76014
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 4-1 (KRTAP4-1) KRTAP type 4 family Q9BYQ7
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Keratin-associated protein 9-4 (KRTAP9-4) KRTAP type 9 family Q9BYQ2
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Brorin (VWC2) . Q2TAL6
Pleckstrin homology domain-containing family F member 2 (PLEKHF2) . Q9H8W4

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.