Details of the Target

General Information of Target

Target ID LDTP10016
Target Name Immunoglobulin superfamily member 8 (IGSF8)
Gene Name IGSF8
Gene ID 93185
Synonyms
CD81P3; EWI2; KCT4; Immunoglobulin superfamily member 8; IgSF8; CD81 partner 3; Glu-Trp-Ile EWI motif-containing protein 2; EWI-2; Keratinocytes-associated transmembrane protein 4; KCT-4; LIR-D1; Prostaglandin regulatory-like protein; PGRL; CD antigen CD316
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAAMPLALLVLLLLGPGGWCLAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITTYNQDNETLEVHPPP
TTTYQDVILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVA
AKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL
Target Bioclass
Immunoglobulin
Subcellular location
Cell membrane
Function
May play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. May regulate proliferation and differentiation of keratinocytes. May be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. May also play a role on integrin-dependent morphology and motility functions. May participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain.
Uniprot ID
Q969P0
Ensemble ID
ENST00000314485.12
HGNC ID
HGNC:17813

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
JURKAT SNV: p.Y389H .
MDAMB468 SNV: p.P355S .
MFE319 SNV: p.E365G .
NCIH1155 SNV: p.S490N .
NCIH23 Insertion: p.V45AfsTer11
SNV: p.V45L		 .
RAMOS Deletion: p.D503QfsTer14 .
RKO Deletion: p.H197PfsTer39 .
RL952 SNV: p.T129A .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
OPA-S-S-alkyne
 Probe Info  		K194(1.00); K143(2.90)  LDD3494  [1]
DBIA
 Probe Info  		C127(2.64)  LDD3332  [2]
Acrolein
 Probe Info  		N.A.  LDD0227  [3]
4-Iodoacetamidophenylacetylene
 Probe Info  		C127(0.00); C186(0.00)  LDD0038  [4]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [4]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C127(1.22)  LDD1510  [5]
 LDCM0259  AC14 HEK-293T C127(1.38)  LDD1512  [5]
 LDCM0270  AC15 HEK-293T C127(0.78)  LDD1513  [5]
 LDCM0280  AC20 HEK-293T C127(0.70)  LDD1519  [5]
 LDCM0282  AC22 HEK-293T C127(1.10)  LDD1521  [5]
 LDCM0283  AC23 HEK-293T C127(0.92)  LDD1522  [5]
 LDCM0288  AC28 HEK-293T C127(0.72)  LDD1527  [5]
 LDCM0291  AC30 HEK-293T C127(0.94)  LDD1530  [5]
 LDCM0292  AC31 HEK-293T C127(0.91)  LDD1531  [5]
 LDCM0297  AC36 HEK-293T C127(0.64)  LDD1536  [5]
 LDCM0299  AC38 HEK-293T C127(1.14)  LDD1538  [5]
 LDCM0300  AC39 HEK-293T C127(0.98)  LDD1539  [5]
 LDCM0301  AC4 HEK-293T C127(1.00)  LDD1540  [5]
 LDCM0306  AC44 HEK-293T C127(0.78)  LDD1545  [5]
 LDCM0308  AC46 HEK-293T C127(1.04)  LDD1547  [5]
 LDCM0309  AC47 HEK-293T C127(1.06)  LDD1548  [5]
 LDCM0315  AC52 HEK-293T C127(1.08)  LDD1554  [5]
 LDCM0317  AC54 HEK-293T C127(1.16)  LDD1556  [5]
 LDCM0318  AC55 HEK-293T C127(0.74)  LDD1557  [5]
 LDCM0323  AC6 HEK-293T C127(1.10)  LDD1562  [5]
 LDCM0324  AC60 HEK-293T C127(0.96)  LDD1563  [5]
 LDCM0326  AC62 HEK-293T C127(1.23)  LDD1565  [5]
 LDCM0327  AC63 HEK-293T C127(0.88)  LDD1566  [5]
 LDCM0334  AC7 HEK-293T C127(0.83)  LDD1568  [5]
 LDCM0368  CL10 HEK-293T C127(1.21)  LDD1572  [5]
 LDCM0379  CL11 HEK-293T C127(0.84)  LDD1583  [5]
 LDCM0408  CL20 HEK-293T C127(1.29)  LDD1612  [5]
 LDCM0410  CL22 HEK-293T C127(1.07)  LDD1614  [5]
 LDCM0411  CL23 HEK-293T C127(1.11)  LDD1615  [5]
 LDCM0421  CL32 HEK-293T C127(1.37)  LDD1625  [5]
 LDCM0423  CL34 HEK-293T C127(0.98)  LDD1627  [5]
 LDCM0424  CL35 HEK-293T C127(1.13)  LDD1628  [5]
 LDCM0434  CL44 HEK-293T C127(0.99)  LDD1638  [5]
 LDCM0436  CL46 HEK-293T C127(0.98)  LDD1640  [5]
 LDCM0437  CL47 HEK-293T C127(0.94)  LDD1641  [5]
 LDCM0447  CL56 HEK-293T C127(1.07)  LDD1650  [5]
 LDCM0449  CL58 HEK-293T C127(1.35)  LDD1652  [5]
 LDCM0450  CL59 HEK-293T C127(0.88)  LDD1653  [5]
 LDCM0460  CL68 HEK-293T C127(1.21)  LDD1663  [5]
 LDCM0463  CL70 HEK-293T C127(1.28)  LDD1666  [5]
 LDCM0464  CL71 HEK-293T C127(0.97)  LDD1667  [5]
 LDCM0473  CL8 HEK-293T C127(0.63)  LDD1676  [5]
 LDCM0474  CL80 HEK-293T C127(1.04)  LDD1677  [5]
 LDCM0476  CL82 HEK-293T C127(1.32)  LDD1679  [5]
 LDCM0477  CL83 HEK-293T C127(0.78)  LDD1680  [5]
 LDCM0487  CL92 HEK-293T C127(0.95)  LDD1690  [5]
 LDCM0489  CL94 HEK-293T C127(1.39)  LDD1692  [5]
 LDCM0490  CL95 HEK-293T C127(0.80)  LDD1693  [5]
 LDCM0022  KB02 A2058 C186(1.62)  LDD2253  [2]
 LDCM0023  KB03 A2058 C186(1.74)  LDD2670  [2]
 LDCM0024  KB05 MKN45 C127(2.64)  LDD3332  [2]
 LDCM0109  NEM HeLa N.A.  LDD0227  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein-glutamine gamma-glutamyltransferase K (TGM1) Transglutaminase family P22735
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 10-4 (KRTAP10-4) KRTAP type 10 family P60372
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 2-4 (KRTAP2-4) KRTAP type 2 family Q9BYR9
Keratin-associated protein 5-7 (KRTAP5-7) KRTAP type 5 family Q6L8G8

References

1 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402