Details of the Target
General Information of Target
Target ID | LDTP10013 | |||||
---|---|---|---|---|---|---|
Target Name | Protein YIPF5 (YIPF5) | |||||
Gene Name | YIPF5 | |||||
Gene ID | 81555 | |||||
Synonyms |
FINGER5; YIP1A; Protein YIPF5; Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5; Smooth muscle cell-associated protein 5; SMAP-5; YIP1 family member 5; YPT-interacting protein 1 A
|
|||||
3D Structure | ||||||
Sequence |
MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT
DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK NCK |
|||||
Target Bioclass |
Other
|
|||||
Family |
YIP1 family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function | Plays a role in transport between endoplasmic reticulum and Golgi. In pancreatic beta cells, required to transport proinsulin from endoplasmic reticulum into the Golgi. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
12.19 | LDD0402 | [1] | |
TH211 Probe Info |
![]() |
Y42(20.00) | LDD0260 | [2] | |
C-Sul Probe Info |
![]() |
5.86 | LDD0066 | [3] | |
Probe 1 Probe Info |
![]() |
Y39(11.60); Y42(175.42) | LDD3495 | [4] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [5] | |
W1 Probe Info |
![]() |
N.A. | LDD0236 | [6] | |
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [7] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DR-1 Probe Info |
![]() |
2.03 | LDD0398 | [8] | |
C220 Probe Info |
![]() |
11.96 | LDD1894 | [9] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References