Details of the Target

General Information of Target

Target ID LDTP09684
Target Name Splicing regulatory glutamine/lysine-rich protein 1 (SREK1)
Gene Name SREK1
Gene ID 140890
Synonyms
SFRS12; SRRP86; Splicing regulatory glutamine/lysine-rich protein 1; Serine/arginine-rich-splicing regulatory protein 86; SRrp86; Splicing factor, arginine/serine-rich 12; Splicing regulatory protein 508; SRrp508
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSK
IDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVP
RALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
SGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHK
KRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDREKEREREKEREKEKERGKNKD
RDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKK
SRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKRE
KERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEHNKEPDSSVSKEVDDKDA
PRTEENKIQHNGNCQLNEENLSTKTEAV
Target Bioclass
Other
Family
Splicing factor SR family
Subcellular location
Nucleus
Function
Participates in the regulation of alternative splicing by modulating the activity of other splice facors. Inhibits the splicing activity of SFRS1, SFRS2 and SFRS6. Augments the splicing activity of SFRS3.
Uniprot ID
Q8WXA9
Ensemble ID
ENST00000334121.11
HGNC ID
HGNC:17882

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 21 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
DBIA
 Probe Info  		C610(1.56)  LDD3312  [2]
BTD
 Probe Info  		C494(0.85)  LDD2092  [3]
Johansson_61
 Probe Info  		_(20.00)  LDD1485  [4]
AHL-Pu-1
 Probe Info  		C494(2.07)  LDD0168  [5]
HHS-475
 Probe Info  		Y69(0.91)  LDD0264  [6]
5E-2FA
 Probe Info  		N.A.  LDD2235  [7]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [8]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [8]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [8]
NAIA_4
 Probe Info  		N.A.  LDD2226  [9]
NAIA_5
 Probe Info  		N.A.  LDD2224  [9]
WYneO
 Probe Info  		N.A.  LDD0022  [10]
Compound 10
 Probe Info  		N.A.  LDD2216  [11]
Compound 11
 Probe Info  		N.A.  LDD2213  [11]
IPM
 Probe Info  		N.A.  LDD0147  [12]
VSF
 Probe Info  		N.A.  LDD0007  [10]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [13]
Acrolein
 Probe Info  		N.A.  LDD0217  [14]
Methacrolein
 Probe Info  		N.A.  LDD0218  [14]
HHS-482
 Probe Info  		Y69(1.06)  LDD2239  [15]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C494(0.90)  LDD2112  [3]
 LDCM0025  4SU-RNA HEK-293T C494(2.07)  LDD0168  [5]
 LDCM0026  4SU-RNA+native RNA HEK-293T C494(2.93)  LDD0169  [5]
 LDCM0156  Aniline NCI-H1299 12.47  LDD0403  [1]
 LDCM0108  Chloroacetamide HeLa C494(0.00); H490(0.00)  LDD0222  [14]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C494(1.05)  LDD1702  [3]
 LDCM0625  F8 Ramos C494(1.74)  LDD2187  [16]
 LDCM0572  Fragment10 Ramos C494(0.91)  LDD2189  [16]
 LDCM0574  Fragment12 Ramos C494(0.68)  LDD2191  [16]
 LDCM0575  Fragment13 Ramos C494(0.79)  LDD2192  [16]
 LDCM0576  Fragment14 Ramos C494(0.79)  LDD2193  [16]
 LDCM0579  Fragment20 Ramos C494(0.42)  LDD2194  [16]
 LDCM0582  Fragment23 Ramos C494(0.87)  LDD2196  [16]
 LDCM0588  Fragment30 Ramos C494(1.08)  LDD2199  [16]
 LDCM0589  Fragment31 Ramos C494(0.60)  LDD2200  [16]
 LDCM0590  Fragment32 Ramos C494(0.91)  LDD2201  [16]
 LDCM0468  Fragment33 Ramos C494(1.06)  LDD2202  [16]
 LDCM0566  Fragment4 Ramos C494(0.97)  LDD2184  [16]
 LDCM0610  Fragment52 Ramos C494(1.14)  LDD2204  [16]
 LDCM0614  Fragment56 Ramos C494(0.70)  LDD2205  [16]
 LDCM0569  Fragment7 Jurkat _(20.00)  LDD1485  [4]
 LDCM0571  Fragment9 Ramos C494(0.53)  LDD2188  [16]
 LDCM0116  HHS-0101 DM93 Y69(0.91)  LDD0264  [6]
 LDCM0117  HHS-0201 DM93 Y69(0.70)  LDD0265  [6]
 LDCM0118  HHS-0301 DM93 Y69(0.90)  LDD0266  [6]
 LDCM0119  HHS-0401 DM93 Y69(1.02)  LDD0267  [6]
 LDCM0120  HHS-0701 DM93 Y69(0.72)  LDD0268  [6]
 LDCM0022  KB02 Ramos C494(1.27)  LDD2182  [16]
 LDCM0023  KB03 MDA-MB-231 C494(2.02)  LDD1701  [3]
 LDCM0024  KB05 HMCB C610(1.56)  LDD3312  [2]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C494(0.85)  LDD2092  [3]
 LDCM0507  Nucleophilic fragment 16b MDA-MB-231 C494(0.63)  LDD2100  [3]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C494(0.74)  LDD2104  [3]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C494(0.78)  LDD2114  [3]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C494(0.98)  LDD2136  [3]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C494(0.74)  LDD2141  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SRSF protein kinase 1 (SRPK1) CMGC Ser/Thr protein kinase family Q96SB4
SRSF protein kinase 2 (SRPK2) CMGC Ser/Thr protein kinase family P78362
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor-associated sorting protein 2 (GPRASP2) GPRASP family Q96D09
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
RNA-binding protein 39 (RBM39) Splicing factor SR family Q14498
Serine/arginine-rich splicing factor 11 (SRSF11) Splicing factor SR family Q05519
Alpha-taxilin (TXLNA) Taxilin family P40222

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
5 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
6 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
9 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
10 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
11 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
12 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
13 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
14 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
15 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
16 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578