Details of the Target
General Information of Target
Target ID | LDTP08450 | |||||
---|---|---|---|---|---|---|
Target Name | Histone H2A type 2-B (H2AC21) | |||||
Gene Name | H2AC21 | |||||
Gene ID | 317772 | |||||
Synonyms |
HIST2H2AB; Histone H2A type 2-B; H2A-clustered histone 21 |
|||||
3D Structure | ||||||
Sequence |
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Histone H2A family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K120(9.22); K125(8.92) | LDD0277 | [1] | |
AZ-9 Probe Info |
![]() |
E92(1.09) | LDD2208 | [2] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [3] | |
m-APA Probe Info |
![]() |
N.A. | LDD2234 | [4] | |
SF Probe Info |
![]() |
K37(0.00); Y40(0.00); K10(0.00) | LDD0028 | [5] | |
1c-yne Probe Info |
![]() |
K119(0.00); K96(0.00) | LDD0228 | [6] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [3] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
Photocelecoxib Probe Info |
![]() |
A54(0.00); V55(0.00); L56(0.00); E57(0.00) | LDD0019 | [7] | |
Photoindomethacin Probe Info |
![]() |
L64(0.00); T60(0.00); I63(0.00); E62(0.00) | LDD0155 | [7] | |
Photonaproxen Probe Info |
![]() |
L56(0.00); I63(0.00); E62(0.00); L59(0.00) | LDD0157 | [7] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References