Details of the Target

General Information of Target

Target ID LDTP08449
Target Name E3 ubiquitin-protein ligase RNF135 (RNF135)
Gene Name RNF135
Gene ID 84282
Synonyms
E3 ubiquitin-protein ligase RNF135; EC 2.3.2.27; RIG-I E3 ubiquitin ligase; REUL; RING finger protein 135; RING finger protein leading to RIG-I activation; Riplet; RING-type E3 ubiquitin transferase RNF135
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACP
TCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRP
ELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDL
SMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPL
PDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTS
QVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAW
HMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH
PGNYLIIKQVKV
Target Bioclass
Enzyme
Subcellular location
Cytoplasm
Function
E2-dependent E3 ubiquitin-protein ligase that functions as a RIGI coreceptor in the sensing of viral RNAs in cell cytoplasm and the activation of the antiviral innate immune response . Together with the UBE2D3, UBE2N and UB2V1 E2 ligases, catalyzes the 'Lys-63'-linked polyubiquitination of RIGI oligomerized on viral RNAs, an essential step in the activation of the RIG-I signaling pathway. Through a ubiquitin-independent parallel mechanism, which consists in bridging RIGI filaments forming on longer viral RNAs, further activates the RIG-I signaling pathway. This second mechanism that synergizes with the ubiquitin-dependent one would thereby allow an RNA length-dependent regulation of the RIG-I signaling pathway (Probable). Associated with the E2 ligase UBE2N, also constitutively synthesizes unanchored 'Lys-63'-linked polyubiquitin chains that may also activate the RIG-I signaling pathway.
Uniprot ID
Q8IUD6
Ensemble ID
ENST00000324689.8
HGNC ID
HGNC:21158

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT116 SNV: p.S168G .
HEC1 SNV: p.S161T DBIA    Probe Info 
JURKAT SNV: p.W360Ter .
KASUMI2 SNV: p.T354A DBIA    Probe Info 
LUDLU1 SNV: p.P409L DBIA    Probe Info 
OVK18 SNV: p.Y85N .
RKO SNV: p.S305F .
ZR751 SNV: p.R56P DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C44(1.43)  LDD3312  [1]
CY4
 Probe Info  		H71(0.00); K74(0.00); Q69(0.00); R73(0.00)  LDD0247  [2]
IPM
 Probe Info  		C103(0.00); C238(0.00)  LDD2156  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C270(1.01)  LDD1510  [4]
 LDCM0259  AC14 HEK-293T C270(0.86)  LDD1512  [4]
 LDCM0280  AC20 HEK-293T C270(0.85)  LDD1519  [4]
 LDCM0282  AC22 HEK-293T C270(0.98)  LDD1521  [4]
 LDCM0288  AC28 HEK-293T C270(0.84)  LDD1527  [4]
 LDCM0291  AC30 HEK-293T C270(0.79)  LDD1530  [4]
 LDCM0297  AC36 HEK-293T C270(0.94)  LDD1536  [4]
 LDCM0299  AC38 HEK-293T C270(1.04)  LDD1538  [4]
 LDCM0301  AC4 HEK-293T C270(1.04)  LDD1540  [4]
 LDCM0306  AC44 HEK-293T C270(0.98)  LDD1545  [4]
 LDCM0308  AC46 HEK-293T C270(0.93)  LDD1547  [4]
 LDCM0315  AC52 HEK-293T C270(1.07)  LDD1554  [4]
 LDCM0317  AC54 HEK-293T C270(1.14)  LDD1556  [4]
 LDCM0323  AC6 HEK-293T C270(0.96)  LDD1562  [4]
 LDCM0324  AC60 HEK-293T C270(1.04)  LDD1563  [4]
 LDCM0326  AC62 HEK-293T C270(0.95)  LDD1565  [4]
 LDCM0368  CL10 HEK-293T C270(1.01)  LDD1572  [4]
 LDCM0408  CL20 HEK-293T C270(1.13)  LDD1612  [4]
 LDCM0410  CL22 HEK-293T C270(0.92)  LDD1614  [4]
 LDCM0421  CL32 HEK-293T C270(1.06)  LDD1625  [4]
 LDCM0423  CL34 HEK-293T C270(0.93)  LDD1627  [4]
 LDCM0434  CL44 HEK-293T C270(0.94)  LDD1638  [4]
 LDCM0436  CL46 HEK-293T C270(1.01)  LDD1640  [4]
 LDCM0447  CL56 HEK-293T C270(1.14)  LDD1650  [4]
 LDCM0449  CL58 HEK-293T C270(1.11)  LDD1652  [4]
 LDCM0460  CL68 HEK-293T C270(1.12)  LDD1663  [4]
 LDCM0463  CL70 HEK-293T C270(1.06)  LDD1666  [4]
 LDCM0473  CL8 HEK-293T C270(0.66)  LDD1676  [4]
 LDCM0474  CL80 HEK-293T C270(1.21)  LDD1677  [4]
 LDCM0476  CL82 HEK-293T C270(1.24)  LDD1679  [4]
 LDCM0487  CL92 HEK-293T C270(1.13)  LDD1690  [4]
 LDCM0489  CL94 HEK-293T C270(1.03)  LDD1692  [4]
 LDCM0022  KB02 697 C44(1.44)  LDD2245  [1]
 LDCM0023  KB03 697 C44(3.05)  LDD2662  [1]
 LDCM0024  KB05 HMCB C44(1.43)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
E3 ubiquitin-protein ligase RNF135 (RNF135) . Q8IUD6
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Alpha-catulin (CTNNAL1) Vinculin/alpha-catenin family Q9UBT7
Heat shock factor 2-binding protein (HSF2BP) . O75031

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402