Details of the Target
General Information of Target
| Target ID | LDTP06659 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tumor protein D53 (TPD52L1) | |||||
| Gene Name | TPD52L1 | |||||
| Gene ID | 7164 | |||||
| Synonyms |
Tumor protein D53; hD53; Tumor protein D52-like 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAK
ERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTA ISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLS STAHASAQSLAGGSRRTKEEELQC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TPD52 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH216 Probe Info |
![]() |
Y96(15.38) | LDD0259 | [1] | |
|
STPyne Probe Info |
![]() |
K109(7.49); K124(5.25); K60(5.56); K68(5.04) | LDD0277 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y96(10.00) | LDD2237 | [3] | |
|
5E-2FA Probe Info |
![]() |
H105(0.00); H184(0.00) | LDD2235 | [4] | |
|
m-APA Probe Info |
![]() |
H105(0.00); H184(0.00); H100(0.00) | LDD2231 | [4] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [5] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [6] | |
|
YN-1 Probe Info |
![]() |
N.A. | LDD0446 | [7] | |
|
Acrolein Probe Info |
![]() |
H100(0.00); H63(0.00) | LDD0217 | [8] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [9] | |
|
HHS-475 Probe Info |
![]() |
Y96(1.90) | LDD2238 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C362 Probe Info |
![]() |
26.91 | LDD2023 | [10] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References












