Details of the Target
General Information of Target
| Target ID | LDTP06628 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2B type 2-E (H2BC21) | |||||
| Gene Name | H2BC21 | |||||
| Gene ID | 8349 | |||||
| Synonyms |
H2BFQ; HIST2H2BE; Histone H2B type 2-E; H2B-clustered histone 21; Histone H2B-GL105; Histone H2B.q; H2B/q |
|||||
| 3D Structure | ||||||
| Sequence |
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.; Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y41(11.42) | LDD0257 | [1] | |
|
TH216 Probe Info |
![]() |
Y41(7.87) | LDD0259 | [1] | |
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [2] | |
|
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [3] | |
|
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [4] | |
|
2PCA Probe Info |
![]() |
K58(0.00); R100(0.00); K109(0.00) | LDD0034 | [5] | |
|
NHS Probe Info |
![]() |
K47(0.00); K58(0.00); K35(0.00); K109(0.00) | LDD0010 | [6] | |
|
SF Probe Info |
![]() |
Y84(0.00); Y41(0.00); K35(0.00); K86(0.00) | LDD0028 | [7] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [6] | |
|
W1 Probe Info |
![]() |
N85(0.00); N64(0.00); Q48(0.00); S57(0.00) | LDD0236 | [8] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BD-F Probe Info |
![]() |
V67(0.00); E72(0.00) | LDD0024 | [9] | |
|
DA-2 Probe Info |
![]() |
N.A. | LDD0071 | [10] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References












