Details of the Target
General Information of Target
Target ID | LDTP06441 | |||||
---|---|---|---|---|---|---|
Target Name | Rho-related GTP-binding protein RhoH (RHOH) | |||||
Gene Name | RHOH | |||||
Gene ID | 399 | |||||
Synonyms |
ARHH; TTF; Rho-related GTP-binding protein RhoH; GTP-binding protein TTF; Translocation three four protein |
|||||
3D Structure | ||||||
Sequence |
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR RLFSINECKIF |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Small GTPase superfamily, Rho family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Negative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for phosphorylation of CD3Z, membrane translocation of ZAP70 and subsequent activation of the ZAP70-mediated pathways. Essential for efficient beta-selection and positive selection by promoting the ZAP70-dependent phosphorylation of the LAT signalosome during pre-TCR and TCR signaling. Crucial for thymocyte maturation during DN3 to DN4 transition and during positive selection. Plays critical roles in mast cell function by facilitating phosphorylation of SYK in Fc epsilon RI-mediated signal transduction. Essential for the phosphorylation of LAT, LCP2, PLCG1 and PLCG2 and for Ca(2+) mobilization in mast cells. Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Inhibits the activation of NF-kappa-B by TNF and IKKB and the activation of CRK/p38 by TNF. Inhibits activities of RAC1, RHOA and CDC42. Negatively regulates leukotriene production in neutrophils.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C130(77.28) | LDD0209 | [1] | |
IA-alkyne Probe Info |
![]() |
C151(0.00); C165(0.00); C130(0.00) | LDD0167 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0202 | EV-93 | T cell | C108(4.05) | LDD0527 | [3] |
LDCM0625 | F8 | Ramos | C130(1.16); C7(0.69); C108(0.91); C151(1.05) | LDD2187 | [4] |
LDCM0572 | Fragment10 | Ramos | C130(1.70); C7(0.76); C108(1.34); C151(1.07) | LDD2189 | [4] |
LDCM0573 | Fragment11 | Ramos | C130(1.44); C7(0.11); C108(2.42); C151(0.38) | LDD2190 | [4] |
LDCM0574 | Fragment12 | Ramos | C130(1.11); C7(1.29); C108(1.39); C151(1.18) | LDD2191 | [4] |
LDCM0575 | Fragment13 | Ramos | C130(1.03); C7(1.21); C108(0.93); C151(0.81) | LDD2192 | [4] |
LDCM0576 | Fragment14 | Ramos | C130(1.03); C7(0.83); C108(1.95); C151(1.24) | LDD2193 | [4] |
LDCM0579 | Fragment20 | Ramos | C130(1.53); C7(1.23); C108(1.62); C151(1.61) | LDD2194 | [4] |
LDCM0580 | Fragment21 | Ramos | C130(1.11); C7(0.92); C108(1.05); C151(0.79) | LDD2195 | [4] |
LDCM0582 | Fragment23 | Ramos | C130(0.59); C7(0.97); C108(0.68); C151(0.52) | LDD2196 | [4] |
LDCM0578 | Fragment27 | Ramos | C130(0.97); C7(0.92); C108(1.15); C151(0.80) | LDD2197 | [4] |
LDCM0586 | Fragment28 | Ramos | C130(0.62); C7(0.69); C108(0.74); C151(0.69) | LDD2198 | [4] |
LDCM0588 | Fragment30 | Ramos | C130(1.20); C7(1.37); C108(0.90); C151(0.93) | LDD2199 | [4] |
LDCM0589 | Fragment31 | Ramos | C130(0.90); C7(0.87); C108(0.99); C151(0.85) | LDD2200 | [4] |
LDCM0590 | Fragment32 | Ramos | C130(1.40); C7(0.80); C108(1.48); C151(0.93) | LDD2201 | [4] |
LDCM0468 | Fragment33 | Ramos | C130(1.23); C7(1.22); C108(0.89); C151(0.73) | LDD2202 | [4] |
LDCM0596 | Fragment38 | Ramos | C130(1.32); C7(1.08); C108(0.74); C151(0.73) | LDD2203 | [4] |
LDCM0566 | Fragment4 | Ramos | C130(1.37); C7(0.94); C108(1.12); C151(1.28) | LDD2184 | [4] |
LDCM0610 | Fragment52 | Ramos | C130(1.13); C7(1.76); C108(0.80); C151(1.58) | LDD2204 | [4] |
LDCM0614 | Fragment56 | Ramos | C130(1.19); C7(1.64); C108(0.98); C151(1.69) | LDD2205 | [4] |
LDCM0569 | Fragment7 | Ramos | C130(1.41); C7(0.84); C108(1.77); C151(1.52) | LDD2186 | [4] |
LDCM0571 | Fragment9 | Ramos | C130(1.69); C7(0.99); C108(2.20); C165(2.10) | LDD2188 | [4] |
LDCM0022 | KB02 | Ramos | 4.58 | LDD0431 | [5] |
LDCM0023 | KB03 | Jurkat | C130(77.28) | LDD0209 | [1] |
LDCM0024 | KB05 | MONO-MAC-6 | C165(1.57) | LDD3335 | [6] |
LDCM0131 | RA190 | MM1.R | C108(1.42) | LDD0304 | [7] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Sulfite oxidase, mitochondrial (SUOX) | . | P51687 |
Transporter and channel
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Transcription factor 19 (TCF19) | . | Q9Y242 |
Other
References