Details of the Target

General Information of Target

Target ID LDTP06415
Target Name Transcriptional enhancer factor TEF-3 (TEAD4)
Gene Name TEAD4
Gene ID 7004
Synonyms
RTEF1; TCF13L1; TEF3; Transcriptional enhancer factor TEF-3; TEA domain family member 4; TEAD-4; Transcription factor 13-like 1; Transcription factor RTEF-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPP
CGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQ
AAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPF
SQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD
TYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWA
DLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYR
IHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS
EHGAQHHIYRLVKE
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
Uniprot ID
Q15561
Ensemble ID
ENST00000358409.7
HGNC ID
HGNC:11717
ChEMBL ID
CHEMBL4295828

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1B SNV: p.V265M .
KARPAS422 Substitution: p.I8_T9delinsMA .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C367(2.33)  LDD0080  [1]
W1
 Probe Info  		C367(0.80)  LDD0239  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [3]
IPM
 Probe Info  		N.A.  LDD2156  [4]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C246
 Probe Info  		44.63  LDD1919  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C367(0.92)  LDD1507  [6]
 LDCM0226  AC11 HEK-293T C367(0.93)  LDD1509  [6]
 LDCM0276  AC17 HEK-293T C367(1.06)  LDD1515  [6]
 LDCM0278  AC19 HEK-293T C367(0.82)  LDD1517  [6]
 LDCM0281  AC21 HEK-293T C367(0.94)  LDD1520  [6]
 LDCM0285  AC25 HEK-293T C367(1.07)  LDD1524  [6]
 LDCM0287  AC27 HEK-293T C367(1.00)  LDD1526  [6]
 LDCM0289  AC29 HEK-293T C367(0.95)  LDD1528  [6]
 LDCM0290  AC3 HEK-293T C367(0.96)  LDD1529  [6]
 LDCM0294  AC33 HEK-293T C367(0.90)  LDD1533  [6]
 LDCM0296  AC35 HEK-293T C367(1.09)  LDD1535  [6]
 LDCM0298  AC37 HEK-293T C367(0.95)  LDD1537  [6]
 LDCM0303  AC41 HEK-293T C367(1.07)  LDD1542  [6]
 LDCM0305  AC43 HEK-293T C367(0.93)  LDD1544  [6]
 LDCM0307  AC45 HEK-293T C367(1.02)  LDD1546  [6]
 LDCM0311  AC49 HEK-293T C367(1.03)  LDD1550  [6]
 LDCM0312  AC5 HEK-293T C367(0.92)  LDD1551  [6]
 LDCM0314  AC51 HEK-293T C367(0.98)  LDD1553  [6]
 LDCM0316  AC53 HEK-293T C367(0.96)  LDD1555  [6]
 LDCM0320  AC57 HEK-293T C367(1.01)  LDD1559  [6]
 LDCM0322  AC59 HEK-293T C367(0.97)  LDD1561  [6]
 LDCM0325  AC61 HEK-293T C367(1.03)  LDD1564  [6]
 LDCM0248  AKOS034007472 HEK-293T C367(0.91)  LDD1511  [6]
 LDCM0356  AKOS034007680 HEK-293T C367(0.94)  LDD1570  [6]
 LDCM0404  CL17 HEK-293T C367(1.17)  LDD1608  [6]
 LDCM0406  CL19 HEK-293T C367(1.09)  LDD1610  [6]
 LDCM0409  CL21 HEK-293T C367(1.12)  LDD1613  [6]
 LDCM0417  CL29 HEK-293T C367(0.88)  LDD1621  [6]
 LDCM0420  CL31 HEK-293T C367(0.96)  LDD1624  [6]
 LDCM0422  CL33 HEK-293T C367(0.85)  LDD1626  [6]
 LDCM0431  CL41 HEK-293T C367(0.92)  LDD1635  [6]
 LDCM0433  CL43 HEK-293T C367(0.91)  LDD1637  [6]
 LDCM0435  CL45 HEK-293T C367(1.05)  LDD1639  [6]
 LDCM0440  CL5 HEK-293T C367(0.99)  LDD1644  [6]
 LDCM0444  CL53 HEK-293T C367(0.96)  LDD1647  [6]
 LDCM0446  CL55 HEK-293T C367(1.04)  LDD1649  [6]
 LDCM0448  CL57 HEK-293T C367(1.33)  LDD1651  [6]
 LDCM0457  CL65 HEK-293T C367(0.99)  LDD1660  [6]
 LDCM0459  CL67 HEK-293T C367(1.11)  LDD1662  [6]
 LDCM0461  CL69 HEK-293T C367(0.86)  LDD1664  [6]
 LDCM0462  CL7 HEK-293T C367(1.19)  LDD1665  [6]
 LDCM0470  CL77 HEK-293T C367(1.09)  LDD1673  [6]
 LDCM0472  CL79 HEK-293T C367(1.13)  LDD1675  [6]
 LDCM0475  CL81 HEK-293T C367(0.97)  LDD1678  [6]
 LDCM0483  CL89 HEK-293T C367(0.94)  LDD1686  [6]
 LDCM0484  CL9 HEK-293T C367(0.95)  LDD1687  [6]
 LDCM0486  CL91 HEK-293T C367(1.04)  LDD1689  [6]
 LDCM0488  CL93 HEK-293T C367(0.97)  LDD1691  [6]
 LDCM0022  KB02 HCT 116 C367(2.33)  LDD0080  [1]
 LDCM0023  KB03 HCT 116 C367(1.46)  LDD0081  [1]
 LDCM0024  KB05 HCT 116 C367(1.03)  LDD0082  [1]
 LDCM0112  W16 Hep-G2 C367(0.80)  LDD0239  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Diamine acetyltransferase 1 (SAT1) Acetyltransferase family P21673
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Other
Click To Hide/Show 26 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
cAMP-dependent protein kinase type I-beta regulatory subunit (PRKAR1B) CAMP-dependent kinase regulatory chain family P31321
Coiled-coil domain-containing protein 172 (CCDC172) CCDC172 family P0C7W6
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Protein LDOC1 (LDOC1) LDOC1 family O95751
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
SEC14 domain and spectrin repeat-containing protein 1 (SESTD1) SOLO family Q86VW0
Transcription cofactor vestigial-like protein 1 (VGLL1) Vestigial family Q99990
Transcription cofactor vestigial-like protein 4 (VGLL4) Vestigial family Q14135
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Vacuolar protein sorting-associated protein VTA1 homolog (VTA1) VTA1 family Q9NP79
Transcriptional coactivator YAP1 (YAP1) YAP1 family P46937
Centrosomal protein of 55 kDa (CEP55) . Q53EZ4
Coiled-coil domain-containing protein 125 (CCDC125) . Q86Z20
Ras association domain-containing protein 10 (RASSF10) . A6NK89
TNF receptor-associated factor 1 (TRAF1) . Q13077
Vinexin (SORBS3) . O60504
WW domain-containing transcription regulator protein 1 (WWTR1) . Q9GZV5

References

1 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
2 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
5 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
6 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402