Details of the Target

General Information of Target

Target ID LDTP06171
Target Name EKC/KEOPS complex subunit LAGE3 (LAGE3)
Gene Name LAGE3
Gene ID 8270
Synonyms
DXS9879E; ESO3; ITBA2; EKC/KEOPS complex subunit LAGE3; L antigen family member 3; Protein ESO-3; Protein ITBA2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRP
HIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISV
INFLDQLSLVVRTMQRFGPPVSR
Target Bioclass
Other
Family
CTAG/PCC1 family
Subcellular location
Cytoplasm
Function
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. LAGE3 functions as a dimerization module for the complex.
Uniprot ID
Q14657
Ensemble ID
ENST00000357360.5
HGNC ID
HGNC:26058

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
Acrolein
 Probe Info  		N.A.  LDD0221  [2]
DBIA
 Probe Info  		C113(1.11)  LDD1514  [3]
5E-2FA
 Probe Info  		N.A.  LDD2235  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [5]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [5]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [5]
NAIA_4
 Probe Info  		N.A.  LDD2226  [6]
IPM
 Probe Info  		N.A.  LDD0147  [7]
Phosphinate-6
 Probe Info  		C113(0.00); C23(0.00)  LDD0018  [8]
AOyne
 Probe Info  		15.00  LDD0443  [9]
NAIA_5
 Probe Info  		C23(0.00); C113(0.00)  LDD2223  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0284  AC24 HEK-293T C113(1.08)  LDD1523  [3]
 LDCM0293  AC32 HEK-293T C113(1.14)  LDD1532  [3]
 LDCM0302  AC40 HEK-293T C113(1.23)  LDD1541  [3]
 LDCM0310  AC48 HEK-293T C113(1.18)  LDD1549  [3]
 LDCM0319  AC56 HEK-293T C113(1.09)  LDD1558  [3]
 LDCM0328  AC64 HEK-293T C113(1.24)  LDD1567  [3]
 LDCM0345  AC8 HEK-293T C113(1.11)  LDD1569  [3]
 LDCM0275  AKOS034007705 HEK-293T C113(1.11)  LDD1514  [3]
 LDCM0156  Aniline NCI-H1299 13.92  LDD0403  [1]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [2]
 LDCM0632  CL-Sc Hep-G2 C23(1.52); C23(0.84)  LDD2227  [6]
 LDCM0390  CL12 HEK-293T C113(0.62)  LDD1594  [3]
 LDCM0412  CL24 HEK-293T C113(0.56)  LDD1616  [3]
 LDCM0425  CL36 HEK-293T C113(0.55)  LDD1629  [3]
 LDCM0438  CL48 HEK-293T C113(0.51)  LDD1642  [3]
 LDCM0452  CL60 HEK-293T C113(0.59)  LDD1655  [3]
 LDCM0465  CL72 HEK-293T C113(0.64)  LDD1668  [3]
 LDCM0478  CL84 HEK-293T C113(0.75)  LDD1681  [3]
 LDCM0491  CL96 HEK-293T C113(1.23)  LDD1694  [3]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C23(1.14)  LDD1702  [10]
 LDCM0625  F8 Ramos C23(2.47)  LDD2187  [11]
 LDCM0572  Fragment10 Ramos C23(1.53); C113(0.98)  LDD2189  [11]
 LDCM0573  Fragment11 Ramos C23(0.05)  LDD2190  [11]
 LDCM0574  Fragment12 Ramos C23(0.65); C113(0.76)  LDD2191  [11]
 LDCM0575  Fragment13 Ramos C23(1.02)  LDD2192  [11]
 LDCM0576  Fragment14 Ramos C23(0.78); C113(0.48)  LDD2193  [11]
 LDCM0579  Fragment20 Ramos C23(0.80); C113(0.83)  LDD2194  [11]
 LDCM0580  Fragment21 Ramos C23(0.90); C113(0.75)  LDD2195  [11]
 LDCM0582  Fragment23 Ramos C23(0.89)  LDD2196  [11]
 LDCM0578  Fragment27 Ramos C23(1.70)  LDD2197  [11]
 LDCM0586  Fragment28 Ramos C23(0.77); C113(0.45)  LDD2198  [11]
 LDCM0588  Fragment30 Ramos C23(1.43)  LDD2199  [11]
 LDCM0589  Fragment31 Ramos C23(0.86)  LDD2200  [11]
 LDCM0590  Fragment32 Ramos C23(2.01); C113(1.91)  LDD2201  [11]
 LDCM0468  Fragment33 Ramos C23(1.48)  LDD2202  [11]
 LDCM0596  Fragment38 Ramos C23(1.52)  LDD2203  [11]
 LDCM0566  Fragment4 Ramos C23(0.66)  LDD2184  [11]
 LDCM0610  Fragment52 Ramos C23(1.25); C113(1.32)  LDD2204  [11]
 LDCM0614  Fragment56 Ramos C23(1.53); C113(1.78)  LDD2205  [11]
 LDCM0569  Fragment7 Ramos C23(0.74)  LDD2186  [11]
 LDCM0571  Fragment9 Ramos C23(0.84); C113(1.12)  LDD2188  [11]
 LDCM0107  IAA HeLa N.A.  LDD0221  [2]
 LDCM0022  KB02 Ramos C23(1.91)  LDD2182  [11]
 LDCM0023  KB03 MDA-MB-231 C23(1.90)  LDD1701  [10]
 LDCM0024  KB05 Ramos C23(0.66)  LDD2185  [11]
 LDCM0109  NEM HeLa N.A.  LDD0223  [2]
 LDCM0627  NUDT7-COV-1 HEK-293T C113(0.98); C23(0.92); C23(0.39)  LDD2206  [12]
 LDCM0628  OTUB2-COV-1 HEK-293T C23(0.94); C23(0.29)  LDD2207  [12]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A (PDE9A) Cyclic nucleotide phosphodiesterase family O76083
Ribonuclease P protein subunit p20 (POP7) Histone-like Alba family O75817
tRNA N6-adenosine threonylcarbamoyltransferase (OSGEP) KAE1 / TsaD family Q9NPF4
Proteasome subunit beta type-9 (PSMB9) Peptidase T1B family P28065
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Other
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
EKC/KEOPS complex subunit GON7 (GON7) . Q9BXV9
Heat shock factor 2-binding protein (HSF2BP) . O75031
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Pleckstrin homology domain-containing family J member 1 (PLEKHJ1) . Q9NW61

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
9 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
10 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
11 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
12 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.