Details of the Target
General Information of Target
| Target ID | LDTP05837 | |||||
|---|---|---|---|---|---|---|
| Target Name | Centromere protein R (ITGB3BP) | |||||
| Gene Name | ITGB3BP | |||||
| Gene ID | 23421 | |||||
| Synonyms |
CENPR; NRIF3; Centromere protein R; CENP-R; Beta-3-endonexin; Integrin beta-3-binding protein; Nuclear receptor-interacting factor 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLS
NEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELE NLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Nucleus
|
|||||
| Function |
Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C39(6.95) | LDD1707 | [1] | |
|
DBIA Probe Info |
![]() |
C127(0.93) | LDD1511 | [2] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [3] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [4] | |
|
AOyne Probe Info |
![]() |
13.60 | LDD0443 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0270 | AC15 | HEK-293T | C127(1.02) | LDD1513 | [2] |
| LDCM0281 | AC21 | HEK-293T | C127(0.95) | LDD1520 | [2] |
| LDCM0283 | AC23 | HEK-293T | C127(0.85) | LDD1522 | [2] |
| LDCM0284 | AC24 | HEK-293T | C127(0.91) | LDD1523 | [2] |
| LDCM0289 | AC29 | HEK-293T | C127(0.98) | LDD1528 | [2] |
| LDCM0292 | AC31 | HEK-293T | C127(1.02) | LDD1531 | [2] |
| LDCM0293 | AC32 | HEK-293T | C127(0.93) | LDD1532 | [2] |
| LDCM0298 | AC37 | HEK-293T | C127(0.96) | LDD1537 | [2] |
| LDCM0300 | AC39 | HEK-293T | C127(1.22) | LDD1539 | [2] |
| LDCM0302 | AC40 | HEK-293T | C127(1.03) | LDD1541 | [2] |
| LDCM0307 | AC45 | HEK-293T | C127(1.00) | LDD1546 | [2] |
| LDCM0309 | AC47 | HEK-293T | C127(1.11) | LDD1548 | [2] |
| LDCM0310 | AC48 | HEK-293T | C127(0.86) | LDD1549 | [2] |
| LDCM0312 | AC5 | HEK-293T | C127(0.92) | LDD1551 | [2] |
| LDCM0316 | AC53 | HEK-293T | C127(1.04) | LDD1555 | [2] |
| LDCM0318 | AC55 | HEK-293T | C127(0.84) | LDD1557 | [2] |
| LDCM0319 | AC56 | HEK-293T | C127(1.04) | LDD1558 | [2] |
| LDCM0325 | AC61 | HEK-293T | C127(1.00) | LDD1564 | [2] |
| LDCM0327 | AC63 | HEK-293T | C127(1.24) | LDD1566 | [2] |
| LDCM0328 | AC64 | HEK-293T | C127(0.98) | LDD1567 | [2] |
| LDCM0334 | AC7 | HEK-293T | C127(0.79) | LDD1568 | [2] |
| LDCM0345 | AC8 | HEK-293T | C127(0.92) | LDD1569 | [2] |
| LDCM0248 | AKOS034007472 | HEK-293T | C127(0.93) | LDD1511 | [2] |
| LDCM0275 | AKOS034007705 | HEK-293T | C127(0.85) | LDD1514 | [2] |
| LDCM0379 | CL11 | HEK-293T | C127(0.77) | LDD1583 | [2] |
| LDCM0390 | CL12 | HEK-293T | C127(0.93) | LDD1594 | [2] |
| LDCM0409 | CL21 | HEK-293T | C127(1.03) | LDD1613 | [2] |
| LDCM0411 | CL23 | HEK-293T | C127(1.20) | LDD1615 | [2] |
| LDCM0412 | CL24 | HEK-293T | C127(0.92) | LDD1616 | [2] |
| LDCM0422 | CL33 | HEK-293T | C127(1.13) | LDD1626 | [2] |
| LDCM0424 | CL35 | HEK-293T | C127(0.88) | LDD1628 | [2] |
| LDCM0425 | CL36 | HEK-293T | C127(0.91) | LDD1629 | [2] |
| LDCM0435 | CL45 | HEK-293T | C127(0.87) | LDD1639 | [2] |
| LDCM0437 | CL47 | HEK-293T | C127(1.11) | LDD1641 | [2] |
| LDCM0438 | CL48 | HEK-293T | C127(0.95) | LDD1642 | [2] |
| LDCM0448 | CL57 | HEK-293T | C127(1.13) | LDD1651 | [2] |
| LDCM0450 | CL59 | HEK-293T | C127(1.14) | LDD1653 | [2] |
| LDCM0452 | CL60 | HEK-293T | C127(1.11) | LDD1655 | [2] |
| LDCM0461 | CL69 | HEK-293T | C127(1.05) | LDD1664 | [2] |
| LDCM0464 | CL71 | HEK-293T | C127(0.95) | LDD1667 | [2] |
| LDCM0465 | CL72 | HEK-293T | C127(1.03) | LDD1668 | [2] |
| LDCM0475 | CL81 | HEK-293T | C127(0.86) | LDD1678 | [2] |
| LDCM0477 | CL83 | HEK-293T | C127(1.02) | LDD1680 | [2] |
| LDCM0478 | CL84 | HEK-293T | C127(0.89) | LDD1681 | [2] |
| LDCM0484 | CL9 | HEK-293T | C127(1.09) | LDD1687 | [2] |
| LDCM0488 | CL93 | HEK-293T | C127(1.13) | LDD1691 | [2] |
| LDCM0490 | CL95 | HEK-293T | C127(1.24) | LDD1693 | [2] |
| LDCM0491 | CL96 | HEK-293T | C127(1.08) | LDD1694 | [2] |
| LDCM0022 | KB02 | T cell | C39(6.95) | LDD1707 | [1] |
| LDCM0024 | KB05 | T cell | C39(6.30) | LDD1709 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Nucleoporin p58/p45 (NUP58) | NUP58 family | Q9BVL2 | |||
| Ceramide transfer protein (CERT1) | . | Q9Y5P4 | |||
Transcription factor
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Limbic system-associated membrane protein (LSAMP) | IgLON family | Q13449 | |||
Other
References





