General Information of Target

Target ID LDTP05837
Target Name Centromere protein R (ITGB3BP)
Gene Name ITGB3BP
Gene ID 23421
Synonyms
CENPR; NRIF3; Centromere protein R; CENP-R; Beta-3-endonexin; Integrin beta-3-binding protein; Nuclear receptor-interacting factor 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLS
NEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELE
NLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
Target Bioclass
Other
Subcellular location
Cytoplasm; Nucleus
Function
Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
Uniprot ID
Q13352
Ensemble ID
ENST00000271002.15
HGNC ID
HGNC:6157

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
MDAMB157 SNV: p.S108G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info 
C39(6.95)  LDD1707  [1]
DBIA
 Probe Info 
C127(0.93)  LDD1511  [2]
IPM
 Probe Info 
N.A.  LDD2156  [3]
Phosphinate-6
 Probe Info 
N.A.  LDD0018  [4]
AOyne
 Probe Info 
13.60  LDD0443  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0270  AC15 HEK-293T C127(1.02)  LDD1513  [2]
 LDCM0281  AC21 HEK-293T C127(0.95)  LDD1520  [2]
 LDCM0283  AC23 HEK-293T C127(0.85)  LDD1522  [2]
 LDCM0284  AC24 HEK-293T C127(0.91)  LDD1523  [2]
 LDCM0289  AC29 HEK-293T C127(0.98)  LDD1528  [2]
 LDCM0292  AC31 HEK-293T C127(1.02)  LDD1531  [2]
 LDCM0293  AC32 HEK-293T C127(0.93)  LDD1532  [2]
 LDCM0298  AC37 HEK-293T C127(0.96)  LDD1537  [2]
 LDCM0300  AC39 HEK-293T C127(1.22)  LDD1539  [2]
 LDCM0302  AC40 HEK-293T C127(1.03)  LDD1541  [2]
 LDCM0307  AC45 HEK-293T C127(1.00)  LDD1546  [2]
 LDCM0309  AC47 HEK-293T C127(1.11)  LDD1548  [2]
 LDCM0310  AC48 HEK-293T C127(0.86)  LDD1549  [2]
 LDCM0312  AC5 HEK-293T C127(0.92)  LDD1551  [2]
 LDCM0316  AC53 HEK-293T C127(1.04)  LDD1555  [2]
 LDCM0318  AC55 HEK-293T C127(0.84)  LDD1557  [2]
 LDCM0319  AC56 HEK-293T C127(1.04)  LDD1558  [2]
 LDCM0325  AC61 HEK-293T C127(1.00)  LDD1564  [2]
 LDCM0327  AC63 HEK-293T C127(1.24)  LDD1566  [2]
 LDCM0328  AC64 HEK-293T C127(0.98)  LDD1567  [2]
 LDCM0334  AC7 HEK-293T C127(0.79)  LDD1568  [2]
 LDCM0345  AC8 HEK-293T C127(0.92)  LDD1569  [2]
 LDCM0248  AKOS034007472 HEK-293T C127(0.93)  LDD1511  [2]
 LDCM0275  AKOS034007705 HEK-293T C127(0.85)  LDD1514  [2]
 LDCM0379  CL11 HEK-293T C127(0.77)  LDD1583  [2]
 LDCM0390  CL12 HEK-293T C127(0.93)  LDD1594  [2]
 LDCM0409  CL21 HEK-293T C127(1.03)  LDD1613  [2]
 LDCM0411  CL23 HEK-293T C127(1.20)  LDD1615  [2]
 LDCM0412  CL24 HEK-293T C127(0.92)  LDD1616  [2]
 LDCM0422  CL33 HEK-293T C127(1.13)  LDD1626  [2]
 LDCM0424  CL35 HEK-293T C127(0.88)  LDD1628  [2]
 LDCM0425  CL36 HEK-293T C127(0.91)  LDD1629  [2]
 LDCM0435  CL45 HEK-293T C127(0.87)  LDD1639  [2]
 LDCM0437  CL47 HEK-293T C127(1.11)  LDD1641  [2]
 LDCM0438  CL48 HEK-293T C127(0.95)  LDD1642  [2]
 LDCM0448  CL57 HEK-293T C127(1.13)  LDD1651  [2]
 LDCM0450  CL59 HEK-293T C127(1.14)  LDD1653  [2]
 LDCM0452  CL60 HEK-293T C127(1.11)  LDD1655  [2]
 LDCM0461  CL69 HEK-293T C127(1.05)  LDD1664  [2]
 LDCM0464  CL71 HEK-293T C127(0.95)  LDD1667  [2]
 LDCM0465  CL72 HEK-293T C127(1.03)  LDD1668  [2]
 LDCM0475  CL81 HEK-293T C127(0.86)  LDD1678  [2]
 LDCM0477  CL83 HEK-293T C127(1.02)  LDD1680  [2]
 LDCM0478  CL84 HEK-293T C127(0.89)  LDD1681  [2]
 LDCM0484  CL9 HEK-293T C127(1.09)  LDD1687  [2]
 LDCM0488  CL93 HEK-293T C127(1.13)  LDD1691  [2]
 LDCM0490  CL95 HEK-293T C127(1.24)  LDD1693  [2]
 LDCM0491  CL96 HEK-293T C127(1.08)  LDD1694  [2]
 LDCM0022  KB02 T cell C39(6.95)  LDD1707  [1]
 LDCM0024  KB05 T cell C39(6.30)  LDD1709  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glycine amidinotransferase, mitochondrial (GATM) Amidinotransferase family P50440
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Ras-related protein Rab-11A (RAB11A) Rab family P62491
GTPase HRas (HRAS) Ras family P01112
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
tRNA modification GTPase GTPBP3, mitochondrial (GTPBP3) TrmE GTPase family Q969Y2
Cytochrome b-c1 complex subunit 7 (UQCRB) UQCRB/QCR7 family P14927
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) . Q8N7C3
Sulfite oxidase, mitochondrial (SUOX) . P51687
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Ceramide transfer protein (CERT1) . Q9Y5P4
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein c-Fos (FOS) BZIP family P01100
Heat shock factor protein 1 (HSF1) HSF family Q00613
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Mesogenin-1 (MSGN1) . A6NI15
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Limbic system-associated membrane protein (LSAMP) IgLON family Q13449
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Axonemal dynein light intermediate polypeptide 1 (DNALI1) Inner dynein arm light chain family O14645
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Nuclear exosome regulator NRDE2 (NRDE2) NRDE2 family Q9H7Z3
Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3) PI3K p85 subunit family Q92569
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Arfaptin-2 (ARFIP2) . P53365
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
Heat shock factor 2-binding protein (HSF2BP) . O75031
Uncharacterized protein C14orf119 (C14orf119) . Q9NWQ9

References

1 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
4 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
5 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.