Details of the Target

General Information of Target

Target ID LDTP05439
Target Name Proto-oncogene c-Rel (REL)
Gene Name REL
Gene ID 5966
Synonyms
Proto-oncogene c-Rel
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV
Target Type
Literature-reported
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.
TTD ID
T22547
Uniprot ID
Q04864
DrugMap ID
TT1ZCTH
Ensemble ID
ENST00000295025.12
HGNC ID
HGNC:9954
ChEMBL ID
CHEMBL4296310

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		13.06  LDD0402  [1]
DBIA
 Probe Info  		C143(2.03)  LDD3334  [2]
BTD
 Probe Info  		C27(1.53)  LDD1700  [3]
DA-P3
 Probe Info  		4.30  LDD0179  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		C151(0.00); C143(0.00)  LDD0038  [5]
IA-alkyne
 Probe Info  		C151(0.00); C143(0.00)  LDD0036  [5]
Lodoacetamide azide
 Probe Info  		C151(0.00); C143(0.00)  LDD0037  [5]
NAIA_4
 Probe Info  		N.A.  LDD2226  [6]
IPM
 Probe Info  		N.A.  LDD2156  [7]
AOyne
 Probe Info  		14.60  LDD0443  [8]
NAIA_5
 Probe Info  		C208(0.00); C84(0.00); C195(0.00)  LDD2223  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0548  1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one MDA-MB-231 C27(0.87)  LDD2142  [3]
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C250(1.02)  LDD2112  [3]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C27(0.98)  LDD2117  [3]
 LDCM0510  3-(4-(Hydroxydiphenylmethyl)piperidin-1-yl)-3-oxopropanenitrile MDA-MB-231 C27(0.87)  LDD2103  [3]
 LDCM0545  Acetamide MDA-MB-231 C27(0.43)  LDD2138  [3]
 LDCM0156  Aniline NCI-H1299 8.15  LDD0403  [1]
 LDCM0498  BS-3668 MDA-MB-231 C27(0.41)  LDD2091  [3]
 LDCM0634  CY-0357 Hep-G2 C143(0.46)  LDD2228  [6]
 LDCM0027  Dopamine HEK-293T 4.30  LDD0179  [4]
 LDCM0625  F8 Ramos C524(0.62)  LDD2187  [9]
 LDCM0574  Fragment12 Ramos C524(0.21)  LDD2191  [9]
 LDCM0575  Fragment13 Ramos C524(0.61)  LDD2192  [9]
 LDCM0576  Fragment14 Ramos C524(2.03)  LDD2193  [9]
 LDCM0579  Fragment20 Ramos C524(0.12)  LDD2194  [9]
 LDCM0580  Fragment21 Ramos C524(0.12)  LDD2195  [9]
 LDCM0582  Fragment23 Ramos C524(0.39)  LDD2196  [9]
 LDCM0578  Fragment27 Ramos C524(0.42)  LDD2197  [9]
 LDCM0586  Fragment28 Ramos C195(0.80); C524(1.16)  LDD2198  [9]
 LDCM0588  Fragment30 Ramos C524(0.13)  LDD2199  [9]
 LDCM0589  Fragment31 Ramos C524(1.52)  LDD2200  [9]
 LDCM0590  Fragment32 Ramos C524(0.65)  LDD2201  [9]
 LDCM0468  Fragment33 Ramos C524(1.01)  LDD2202  [9]
 LDCM0596  Fragment38 Ramos C524(0.10)  LDD2203  [9]
 LDCM0566  Fragment4 Ramos C524(0.23)  LDD2184  [9]
 LDCM0610  Fragment52 Ramos C524(0.36)  LDD2204  [9]
 LDCM0614  Fragment56 Ramos C524(0.12)  LDD2205  [9]
 LDCM0569  Fragment7 Ramos C195(0.83); C524(2.46)  LDD2186  [9]
 LDCM0571  Fragment9 Ramos C524(0.87)  LDD2188  [9]
 LDCM0022  KB02 HEK-293T C143(1.07); C524(0.90)  LDD1492  [10]
 LDCM0023  KB03 HEK-293T C143(1.32); C524(0.95)  LDD1497  [10]
 LDCM0024  KB05 MOLM-16 C143(2.03)  LDD3334  [2]
 LDCM0509  N-(4-bromo-3,5-dimethylphenyl)-2-nitroacetamide MDA-MB-231 C27(0.89)  LDD2102  [3]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C27(0.80)  LDD2121  [3]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C27(0.91)  LDD2089  [3]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C27(1.07)  LDD2090  [3]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C27(0.86)  LDD2092  [3]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C27(1.07)  LDD2093  [3]
 LDCM0501  Nucleophilic fragment 13b MDA-MB-231 C27(1.05)  LDD2094  [3]
 LDCM0503  Nucleophilic fragment 14b MDA-MB-231 C27(0.29)  LDD2096  [3]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C27(0.98)  LDD2098  [3]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C27(0.83)  LDD2099  [3]
 LDCM0507  Nucleophilic fragment 16b MDA-MB-231 C27(0.79)  LDD2100  [3]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C27(0.66)  LDD2104  [3]
 LDCM0512  Nucleophilic fragment 19a MDA-MB-231 C27(1.47)  LDD2105  [3]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C27(1.12)  LDD2107  [3]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C27(1.04)  LDD2108  [3]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C27(0.76); C195(0.91)  LDD2109  [3]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C27(1.00)  LDD2111  [3]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C27(0.59)  LDD2114  [3]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C27(0.89)  LDD2120  [3]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C27(0.77)  LDD2125  [3]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C27(0.92)  LDD2127  [3]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C27(0.87)  LDD2129  [3]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C27(0.98)  LDD2135  [3]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C27(1.49)  LDD2136  [3]
 LDCM0211  Nucleophilic fragment 3b MDA-MB-231 C27(1.53)  LDD1700  [3]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C27(0.78)  LDD2140  [3]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C27(0.68)  LDD2141  [3]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C27(0.80)  LDD2146  [3]
 LDCM0627  NUDT7-COV-1 HEK-293T C27(0.96)  LDD2206  [11]
 LDCM0628  OTUB2-COV-1 HEK-293T C27(0.96)  LDD2207  [11]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 76 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4) 1-acyl-sn-glycerol-3-phosphate acyltransferase family Q9NRZ5
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
Diamine acetyltransferase 1 (SAT1) Acetyltransferase family P21673
DNA-directed RNA polymerases I, II, and III subunit RPABC5 (POLR2L) Archaeal Rpo10/eukaryotic RPB10 RNA polymerase subunit family P62875
Acyl-coenzyme A thioesterase 8 (ACOT8) C/M/P thioester hydrolase family O14734
PR domain zinc finger protein 10 (PRDM10) Class V-like SAM-binding methyltransferase superfamily Q9NQV6
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Polynucleotide 5'-hydroxyl-kinase NOL9 (NOL9) Clp1 family Q5SY16
Exosome complex component CSL4 (EXOSC1) CSL4 family Q9Y3B2
Ethanolamine-phosphate cytidylyltransferase (PCYT2) Cytidylyltransferase family Q99447
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Eukaryotic initiation factor 4A-III (EIF4A3) DEAD box helicase family P38919
Deoxyhypusine synthase (DHPS) Deoxyhypusine synthase family P49366
Probable palmitoyltransferase ZDHHC24 (ZDHHC24) DHHC palmitoyltransferase family Q6UX98
Thioredoxin-like protein 4B (TXNL4B) DIM1 family Q9NX01
DNA polymerase epsilon subunit 2 (POLE2) DNA polymerase epsilon subunit B family P56282
DNA nucleotidylexotransferase (DNTT) DNA polymerase type-X family P04053
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
N-acetyl-D-glucosamine kinase (NAGK) Eukaryotic-type N-acetylglucosamine kinase family Q9UJ70
Ribonuclease P/MRP protein subunit POP5 (POP5) Eukaryotic/archaeal RNase P protein component 2 family Q969H6
Peptidyl-prolyl cis-trans isomerase FKBP1B (FKBP1B) FKBP-type PPIase family P68106
Endonuclease 8-like 2 (NEIL2) FPG family Q969S2
Neuroglobin (NGB) Globin family Q9NPG2
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Alpha-(1,3)-fucosyltransferase 11 (FUT11) Glycosyltransferase 10 family Q495W5
Histone acetyltransferase type B catalytic subunit (HAT1) HAT1 family O14929
Polyunsaturated fatty acid 5-lipoxygenase (ALOX5) Lipoxygenase family P09917
Nucleotidyltransferase MB21D2 (MB21D2) Mab-21 family Q8IYB1
Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein (ASMTL) Maf family O95671
FAD synthase (FLAD1) MoaB/Mog family; PAPS reductase family Q8NFF5
Nucleoside diphosphate kinase homolog 7 (NME7) NDK family Q9Y5B8
Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14) Nudix hydrolase family O95848
Diphosphoinositol polyphosphate phosphohydrolase 3-alpha (NUDT10) Nudix hydrolase family Q8NFP7
E3 ubiquitin-protein ligase pellino homolog 2 (PELI2) Pellino family Q9HAT8
Ubiquitin thioesterase OTUB2 (OTUB2) Peptidase C65 family Q96DC9
Leucyl-cystinyl aminopeptidase (LNPEP) Peptidase M1 family Q9UIQ6
72 kDa type IV collagenase (MMP2) Peptidase M10A family P08253
Xaa-Arg dipeptidase (PM20D2) Peptidase M20A family Q8IYS1
AMSH-like protease (STAMBPL1) Peptidase M67C family Q96FJ0
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit alpha type-4 (PSMA4) Peptidase T1A family P25789
Protein-arginine deiminase type-3 (PADI3) Protein arginine deiminase family Q9ULW8
RAC-beta serine/threonine-protein kinase (AKT2) AGC Ser/Thr protein kinase family P31751
Testis-specific serine/threonine-protein kinase 3 (TSSK3) CAMK Ser/Thr protein kinase family Q96PN8
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
Casein kinase II subunit alpha (CSNK2A1) Ser/Thr protein kinase family P68400
Serine/threonine-protein kinase WNK3 (WNK3) Ser/Thr protein kinase family Q9BYP7
Protein-tyrosine kinase 6 (PTK6) Tyr protein kinase family Q13882
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
E3 ubiquitin-protein ligase ARIH2 (ARIH2) RBR family O95376
Putative exonuclease GOR (REXO1L1P) REXO1/REXO3 family Q8IX06
DNA-directed RNA polymerase I subunit RPA1 (POLR1A) RNA polymerase beta' chain family O95602
Exosome complex component RRP43 (EXOSC8) RNase PH family Q96B26
Exosome complex component RRP46 (EXOSC5) RNase PH family Q9NQT4
17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14) Short-chain dehydrogenases/reductases (SDR) family Q9BPX1
ADP-ribosylation factor-like protein 16 (ARL16) Arf family Q0P5N6
Ras-related protein Rab-41 (RAB41) Rab family Q5JT25
Ras-related protein Rab-7L1 (RAB29) Rab family O14966
Sulfotransferase 2B1 (SULT2B1) Sulfotransferase 1 family O00204
Post-GPI attachment to proteins factor 6 (PGAP6) TMEM8 family Q9HCN3
E3 ubiquitin-protein ligase TRIM68 (TRIM68) TRIM/RBCC family Q6AZZ1
Ubiquitin-conjugating enzyme E2 D4 (UBE2D4) Ubiquitin-conjugating enzyme family Q9Y2X8
Ubiquitin-conjugating enzyme E2 K (UBE2K) Ubiquitin-conjugating enzyme family P61086
Ubiquitin-conjugating enzyme E2 Z (UBE2Z) Ubiquitin-conjugating enzyme family Q9H832
Nicotinamide riboside kinase 1 (NMRK1) Uridine kinase family Q9NWW6
V-type proton ATPase subunit d 2 (ATP6V0D2) V-ATPase V0D/AC39 subunit family Q8N8Y2
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (PLCB4) . Q15147
Acetyl-coenzyme A thioesterase (ACOT12) . Q8WYK0
OTU domain-containing protein 4 (OTUD4) . Q01804
Prolyl hydroxylase EGLN3 (EGLN3) . Q9H6Z9
Sulfite oxidase, mitochondrial (SUOX) . P51687
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2) . Q5T7W7
Ubiquitin-associated and SH3 domain-containing protein B (UBASH3B) . Q8TF42
Transporter and channel
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Autophagy-related protein 9A (ATG9A) ATG9 family Q7Z3C6
Bardet-Biedl syndrome 4 protein (BBS4) BBS4 family Q96RK4
Voltage-dependent L-type calcium channel subunit alpha-1S (CACNA1S) Calcium channel alpha-1 subunit (TC 1.A.1.11) family Q13698
Eukaryotic translation initiation factor 5A-1 (EIF5A) EIF-5A family P63241
Eukaryotic translation initiation factor 5A-2 (EIF5A2) EIF-5A family Q9GZV4
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Huntingtin-interacting protein 1 (HIP1) SLA2 family O00291
Solute carrier family 41 member 3 (SLC41A3) SLC41A transporter family Q96GZ6
Sodium- and chloride-dependent betaine transporter (SLC6A12) Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family P48065
Protein transport protein Sec31A (SEC31A) WD repeat SEC31 family O94979
Zinc transporter ZIP13 (SLC39A13) ZIP transporter (TC 2.A.5) family Q96H72
SEC14-like protein 4 (SEC14L4) . Q9UDX3
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Syntenin-1 (SDCBP) . O00560
THO complex subunit 1 (THOC1) . Q96FV9
Transcription factor
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BarH-like 2 homeobox protein (BARHL2) BAR homeobox family Q9NY43
Nuclear factor erythroid 2-related factor 2 (NFE2L2) BZIP family Q16236
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein ZIC 1 (ZIC1) GLI C2H2-type zinc-finger protein family Q15915
Zinc finger and BTB domain-containing protein 16 (ZBTB16) Krueppel C2H2-type zinc-finger protein family Q05516
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 550 (ZNF550) Krueppel C2H2-type zinc-finger protein family Q7Z398
Zinc finger protein 564 (ZNF564) Krueppel C2H2-type zinc-finger protein family Q8TBZ8
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
Zinc finger protein 765 (ZNF765) Krueppel C2H2-type zinc-finger protein family Q7L2R6
NF-kappa-B inhibitor alpha (NFKBIA) NF-kappa-B inhibitor family P25963
NF-kappa-B inhibitor epsilon (NFKBIE) NF-kappa-B inhibitor family O00221
Steroid hormone receptor ERR1 (ESRRA) Nuclear hormone receptor family P11474
Homeobox protein SIX1 (SIX1) SIX/Sine oculis homeobox family Q15475
TSC22 domain family protein 3 (TSC22D3) TSC-22/Dip/Bun family Q99576
B-cell lymphoma 6 protein (BCL6) . P41182
Forkhead box protein O4 (FOXO4) . P98177
Neurogenin-3 (NEUROG3) . Q9Y4Z2
Nuclear factor NF-kappa-B p100 subunit (NFKB2) . Q00653
T-cell leukemia homeobox protein 3 (TLX3) . O43711
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
HLA class II histocompatibility antigen, DO alpha chain (HLA-DOA) MHC class II family P06340
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-36 receptor antagonist protein (IL36RN) IL-1 family Q9UBH0
Other
Click To Hide/Show 120 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Ataxin-1 (ATXN1) ATXN1 family P54253
Bcl-2-modifying factor (BMF) Bcl-2 family Q96LC9
Enhancer of filamentation 1 (NEDD9) CAS family Q14511
Cyclin-dependent kinase inhibitor 1 (CDKN1A) CDI family P38936
Cyclin-dependent kinase 4 inhibitor C (CDKN2C) CDKN2 cyclin-dependent kinase inhibitor family P42773
Cyclin-dependent kinase 4 inhibitor D (CDKN2D) CDKN2 cyclin-dependent kinase inhibitor family P55273
Cerebellar degeneration-related protein 2-like (CDR2L) CDR2 family Q86X02
Centromere protein X (CENPX) CENP-X/MHF2 family A8MT69
Centrosomal protein of 19 kDa (CEP19) CEP19 family Q96LK0
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
Chromatin assembly factor 1 subunit A (CHAF1A) CHAF1A family Q13111
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
Cyclin-dependent kinase 2-interacting protein (CINP) CINP family Q9BW66
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Copine-2 (CPNE2) Copine family Q96FN4
Cleavage and polyadenylation specificity factor subunit 1 (CPSF1) CPSF1 family Q10570
Beta-catenin-interacting protein 1 (CTNNBIP1) CTNNBIP1 family Q9NSA3
Splicing factor YJU2 (YJU2) CWC16 family Q9BW85
Cyclin-C (CCNC) Cyclin family P24863
Cyclin-J-like protein (CCNJL) Cyclin family, Cyclin J subfamily Q8IV13
Guanine nucleotide exchange factor MSS4 (RABIF) DSS4/MSS4 family P47224
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Dynein light intermediate chain family Q9Y6G9
Eukaryotic translation initiation factor 3 subunit A (EIF3A) EIF-3 subunit A family Q14152
Eukaryotic translation initiation factor 3 subunit D (EIF3D) EIF-3 subunit D family O15371
Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1) EIF4E-binding protein family Q13541
Eukaryotic translation initiation factor 4E type 2 (EIF4E2) Eukaryotic initiation factor 4E family O60573
Retrotransposon Gag-like protein 8C (RTL8C) FAM127 family A6ZKI3
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Radial spoke head 14 homolog (RSPH14) Flagellar radial spoke RSP14 family Q9UHP6
Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) GADD45 family O95257
GRB2-related adapter protein (GRAP) GRB2/sem-5/DRK family Q13588
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Keratin-associated protein 9-4 (KRTAP9-4) KRTAP type 9 family Q9BYQ2
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Microtubule-associated protein RP/EB family member 3 (MAPRE3) MAPRE family Q9UPY8
Protein MEMO1 (MEMO1) MEMO1 family Q9Y316
G-patch domain and KOW motifs-containing protein (GPKOW) MOS2 family Q92917
Maturin (MTURN) MTURN family Q8N3F0
Nuclear receptor 2C2-associated protein (NR2C2AP) NR2C2AP family Q86WQ0
Ornithine decarboxylase antizyme 3 (OAZ3) ODC antizyme family Q9UMX2
Oxidative stress-induced growth inhibitor 1 (OSGIN1) OKL38 family Q9UJX0
Gamma-parvin (PARVG) Parvin family Q9HBI0
Prostate and testis expressed protein 1 (PATE1) PATE family Q8WXA2
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
UV excision repair protein RAD23 homolog A (RAD23A) RAD23 family P54725
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
Protein ripply1 (RIPPLY1) Ripply family Q0D2K3
Migration and invasion enhancer 1 (MIEN1) SelWTH family Q9BRT3
tRNA-splicing endonuclease subunit Sen15 (TSEN15) SEN15 family Q8WW01
Heat shock protein beta-7 (HSPB7) Small heat shock protein (HSP20) family Q9UBY9
Nonsense-mediated mRNA decay factor SMG9 (SMG9) SMG9 family Q9H0W8
U6 snRNA-associated Sm-like protein LSm2 (LSM2) SnRNP Sm proteins family Q9Y333
SOSS complex subunit B2 (NABP1) SOSS-B family Q96AH0
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
T-cell leukemia/lymphoma protein 1A (TCL1A) TCL1 family P56279
T-complex protein 11-like protein 1 (TCP11L1) TCP11 family Q9NUJ3
Trafficking protein particle complex subunit 2-like protein (TRAPPC2L) TRAPP small subunits family Q9UL33
U5 small nuclear ribonucleoprotein TSSC4 (TSSC4) TSSC4 family Q9Y5U2
Tetratricopeptide repeat protein 19, mitochondrial (TTC19) TTC19 family Q6DKK2
Large ribosomal subunit protein uL10m (MRPL10) Universal ribosomal protein uL10 family Q7Z7H8
UPF0696 protein C11orf68 (C11orf68) UPF0696 family Q9H3H3
UPF0739 protein C1orf74 (C1orf74) UPF0739 family Q96LT6
Vacuolar protein-sorting-associated protein 25 (VPS25) VPS25 family Q9BRG1
Echinoderm microtubule-associated protein-like 2 (EML2) WD repeat EMAP family O95834
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
APOBEC1 complementation factor (A1CF) . Q9NQ94
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3) . Q8TDY4
Arfaptin-2 (ARFIP2) . P53365
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Bcl-2-like protein 15 (BCL2L15) . Q5TBC7
BH3-interacting domain death agonist (BID) . P55957
BTB/POZ domain-containing protein KCTD6 (KCTD6) . Q8NC69
Calcium and integrin-binding family member 3 (CIB3) . Q96Q77
Calcium-binding protein 5 (CABP5) . Q9NP86
CAP-Gly domain-containing linker protein 1 (CLIP1) . P30622
CGG triplet repeat-binding protein 1 (CGGBP1) . Q9UFW8
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (CHCHD2) . Q9Y6H1
Collagen alpha-1(VIII) chain (COL8A1) . P27658
COMM domain-containing protein 1 (COMMD1) . Q8N668
Cytoplasmic protein NCK2 (NCK2) . O43639
Differentially expressed in FDCP 6 homolog (DEF6) . Q9H4E7
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
Emerin (EMD) . P50402
EPM2A-interacting protein 1 (EPM2AIP1) . Q7L775
Fibronectin type III domain-containing protein 11 (FNDC11) . Q9BVV2
Four and a half LIM domains protein 2 (FHL2) . Q14192
Guanine nucleotide exchange factor C9orf72 (C9orf72) . Q96LT7
Heterogeneous nuclear ribonucleoprotein F (HNRNPF) . P52597
Kelch-like protein 42 (KLHL42) . Q9P2K6
Lethal(3)malignant brain tumor-like protein 2 (L3MBTL2) . Q969R5
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
LIM and SH3 domain protein 1 (LASP1) . Q14847
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Mitotic spindle assembly checkpoint protein MAD2B (MAD2L2) . Q9UI95
Mortality factor 4-like protein 1 (MORF4L1) . Q9UBU8
Mortality factor 4-like protein 2 (MORF4L2) . Q15014
NTF2-related export protein 2 (NXT2) . Q9NPJ8
Osteoclast-stimulating factor 1 (OSTF1) . Q92882
Placental protein 13-like (LGALS14) . Q8TCE9
Pleckstrin homology domain-containing family N member 1 (PLEKHN1) . Q494U1
PRKCA-binding protein (PICK1) . Q9NRD5
Protein FAM200C (FAM200C) . Q8IZ13
Protein MENT (MENT) . Q9BUN1
Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) . Q9UIG4
Ras association domain-containing protein 5 (RASSF5) . Q8WWW0
Rhombotin-1 (LMO1) . P25800
Rhombotin-2 (LMO2) . P25791
SHC-transforming protein 3 (SHC3) . Q92529
Sterile alpha motif domain-containing protein 11 (SAMD11) . Q96NU1
TBC1 domain family member 21 (TBC1D21) . Q8IYX1
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
TNFAIP3-interacting protein 2 (TNIP2) . Q8NFZ5
U11/U12 small nuclear ribonucleoprotein 25 kDa protein (SNRNP25) . Q9BV90
Ubiquitin-associated and SH3 domain-containing protein A (UBASH3A) . P57075
UBX domain-containing protein 7 (UBXN7) . O94888
Uncharacterized protein C14orf119 (C14orf119) . Q9NWQ9
Uncharacterized protein C1orf50 (C1orf50) . Q9BV19

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
8 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
9 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
10 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
11 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.