Details of the Target
General Information of Target
| Target ID | LDTP05232 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PPP2R2B) | |||||
| Gene Name | PPP2R2B | |||||
| Gene ID | 5521 | |||||
| Synonyms |
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform; PP2A subunit B isoform B55-beta; PP2A subunit B isoform PR55-beta; PP2A subunit B isoform R2-beta; PP2A subunit B isoform beta
|
|||||
| 3D Structure | ||||||
| Sequence |
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW HPSENIIAVAATNNLYIFQDKVN |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Phosphatase 2A regulatory subunit B family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is required to promote proapoptotic activity. Isoform 2 regulates neuronal survival through the mitochondrial fission and fusion balance.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CCK81 | SNV: p.S285L | DBIA Probe Info | |||
| HT115 | SNV: p.S190F | DBIA Probe Info | |||
| IGR1 | SNV: p.D184N | DBIA Probe Info | |||
| IGROV1 | SNV: p.N197S | DBIA Probe Info | |||
| Ishikawa (Heraklio) 02 ER | Deletion: p.G46VfsTer4 | DBIA Probe Info | |||
| MFE296 | Deletion: p.Q100SfsTer16 | DBIA Probe Info | |||
| MOLT4 | SNV: p.A254P | . | |||
| NCIH2286 | SNV: p.Q101H | DBIA Probe Info | |||
| SH4 | SNV: p.V395G | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C394(0.61) | LDD2229 | [1] | |
|
DBIA Probe Info |
![]() |
C364(1.84) | LDD3311 | [2] | |
|
HHS-475 Probe Info |
![]() |
Y82(3.70) | LDD0264 | [3] | |
|
CY4 Probe Info |
![]() |
Q55(0.00); Q60(0.00) | LDD0247 | [4] | |
|
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [5] | |
|
WYneO Probe Info |
![]() |
C330(0.00); C258(0.00) | LDD0022 | [5] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [6] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [7] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DA-2 Probe Info |
![]() |
N.A. | LDD0070 | [8] | |
|
STS-1 Probe Info |
![]() |
N.A. | LDD0068 | [9] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y82(3.70) | LDD0264 | [3] |
| LDCM0117 | HHS-0201 | DM93 | Y82(3.47) | LDD0265 | [3] |
| LDCM0118 | HHS-0301 | DM93 | Y82(3.75) | LDD0266 | [3] |
| LDCM0119 | HHS-0401 | DM93 | Y82(4.06) | LDD0267 | [3] |
| LDCM0120 | HHS-0701 | DM93 | Y82(1.76) | LDD0268 | [3] |
| LDCM0022 | KB02 | 22RV1 | C364(1.49) | LDD2243 | [2] |
| LDCM0023 | KB03 | 22RV1 | C364(1.60) | LDD2660 | [2] |
| LDCM0024 | KB05 | G361 | C364(1.84) | LDD3311 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amyloid-beta precursor protein (APP) | APP family | P05067 | |||
References










