Details of the Target
General Information of Target
| Target ID | LDTP04889 | |||||
|---|---|---|---|---|---|---|
| Target Name | Signal peptidase complex subunit 3 (SPCS3) | |||||
| Gene Name | SPCS3 | |||||
| Gene ID | 60559 | |||||
| Synonyms |
SPC22; Signal peptidase complex subunit 3; Microsomal signal peptidase 22/23 kDa subunit; SPC22/23; SPase 22/23 kDa subunit |
|||||
| 3D Structure | ||||||
| Sequence |
MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER
SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL KDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
SPCS3 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Essential component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Essential for the SPC catalytic activity, possibly by stabilizing and positioning the active center of the complex close to the lumenal surface.; (Microbial infection) Plays an important role in virion production of flaviviruses such as West Nile virus, Japanese enchephalitis virus, Dengue virus type 2 and Yellow Fever virus.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
|
STPyne Probe Info |
![]() |
K121(6.67); K49(7.26) | LDD0277 | [2] | |
|
Alkyne-RA190 Probe Info |
![]() |
3.57 | LDD0299 | [3] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [4] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [5] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C094 Probe Info |
![]() |
22.94 | LDD1785 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Ataxin-1 (ATXN1) | ATXN1 family | P54253 | |||
References






