Details of the Target

General Information of Target

Target ID LDTP04873
Target Name Reactive oxygen species modulator 1 (ROMO1)
Gene Name ROMO1
Gene ID 140823
Synonyms
C20orf52; Reactive oxygen species modulator 1; ROS modulator 1; Epididymis tissue protein Li 175; Glyrichin; Mitochondrial targeting GxxxG motif protein; MTGM; Protein MGR2 homolog
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
Target Bioclass
Transporter and channel
Family
MGR2 family
Subcellular location
Mitochondrion inner membrane
Function
Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.; Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.
Uniprot ID
P60602
Ensemble ID
ENST00000336695.4
HGNC ID
HGNC:16185

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CALU6 SNV: p.T69R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-4
 Probe Info  		100.00  LDD0445  [1]
IPM
 Probe Info  		N.A.  LDD0241  [2]
BTD
 Probe Info  		C15(1.17)  LDD2090  [3]
ART-yne
 Probe Info  		2.12  LDD0234  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [5]
IA-alkyne
 Probe Info  		N.A.  LDD0032  [6]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [5]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [7]
TFBX
 Probe Info  		N.A.  LDD0027  [7]
WYneN
 Probe Info  		N.A.  LDD0021  [8]
Acrolein
 Probe Info  		N.A.  LDD0217  [9]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [9]
NAIA_5
 Probe Info  		N.A.  LDD2223  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C15(0.88)  LDD2117  [3]
 LDCM0091  Astemisinin MCF-7 2.12  LDD0234  [4]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [9]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C15(6.59)  LDD1702  [3]
 LDCM0625  F8 Ramos C15(0.83)  LDD2187  [11]
 LDCM0572  Fragment10 Ramos C15(0.85)  LDD2189  [11]
 LDCM0574  Fragment12 Ramos C15(1.08)  LDD2191  [11]
 LDCM0575  Fragment13 Ramos C15(0.95)  LDD2192  [11]
 LDCM0576  Fragment14 Ramos C15(4.77)  LDD2193  [11]
 LDCM0579  Fragment20 Ramos C15(0.97)  LDD2194  [11]
 LDCM0580  Fragment21 Ramos C15(1.02)  LDD2195  [11]
 LDCM0582  Fragment23 Ramos C15(0.67)  LDD2196  [11]
 LDCM0578  Fragment27 Ramos C15(0.66)  LDD2197  [11]
 LDCM0586  Fragment28 Ramos C15(0.88)  LDD2198  [11]
 LDCM0588  Fragment30 Ramos C15(0.99)  LDD2199  [11]
 LDCM0589  Fragment31 Ramos C15(1.79)  LDD2200  [11]
 LDCM0590  Fragment32 Ramos C15(0.86)  LDD2201  [11]
 LDCM0468  Fragment33 Ramos C15(1.00)  LDD2202  [11]
 LDCM0596  Fragment38 Ramos C15(0.98)  LDD2203  [11]
 LDCM0566  Fragment4 Ramos C15(1.40)  LDD2184  [11]
 LDCM0610  Fragment52 Ramos C15(1.23)  LDD2204  [11]
 LDCM0614  Fragment56 Ramos C15(0.92)  LDD2205  [11]
 LDCM0569  Fragment7 Ramos C15(0.85)  LDD2186  [11]
 LDCM0571  Fragment9 Ramos C15(1.07)  LDD2188  [11]
 LDCM0107  IAA HeLa N.A.  LDD0221  [9]
 LDCM0022  KB02 Ramos C15(0.94)  LDD2182  [11]
 LDCM0023  KB03 MDA-MB-231 C15(4.27)  LDD1701  [3]
 LDCM0024  KB05 Ramos C15(1.43)  LDD2185  [11]
 LDCM0109  NEM HeLa N.A.  LDD0229  [9]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C15(1.17)  LDD2090  [3]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C15(1.01)  LDD2129  [3]
 LDCM0628  OTUB2-COV-1 HEK-293T C15(0.33)  LDD2207  [12]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lipid transferase CIDEB (CIDEB) CIDE family Q9UHD4

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
2 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Artemisinin inhibits NRas palmitoylation by targeting the protein acyltransferase ZDHHC6. Cell Chem Biol. 2022 Mar 17;29(3):530-537.e7. doi: 10.1016/j.chembiol.2021.07.012. Epub 2021 Aug 5.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
9 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
10 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
11 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
12 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.