Details of the Target

General Information of Target

Target ID LDTP04739
Target Name AP-1 complex subunit sigma-2 (AP1S2)
Gene Name AP1S2
Gene ID 8905
Synonyms
AP-1 complex subunit sigma-2; Adaptor protein complex AP-1 subunit sigma-1B; Adaptor-related protein complex 1 subunit sigma-1B; Clathrin assembly protein complex 1 sigma-1B small chain; Golgi adaptor HA1/AP1 adaptin sigma-1B subunit; Sigma 1B subunit of AP-1 clathrin; Sigma-adaptin 1B; Sigma1B-adaptin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Target Bioclass
Other
Family
Adaptor complexes small subunit family
Subcellular location
Golgi apparatus
Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Uniprot ID
P56377
Ensemble ID
ENST00000329235.6
HGNC ID
HGNC:560

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
1oxF11yne
 Probe Info  		N.A.  LDD0193  [1]
STPyne
 Probe Info  		K132(1.25)  LDD0277  [2]
m-APA
 Probe Info  		15.00  LDD0403  [3]
DBIA
 Probe Info  		C88(4.08)  LDD3310  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [5]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [5]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [5]
NAIA_5
 Probe Info  		N.A.  LDD2223  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [3]
 LDCM0625  F8 Ramos C46(5.60)  LDD2187  [7]
 LDCM0572  Fragment10 Ramos C46(0.66)  LDD2189  [7]
 LDCM0573  Fragment11 Ramos C46(0.10)  LDD2190  [7]
 LDCM0574  Fragment12 Ramos C46(0.86)  LDD2191  [7]
 LDCM0575  Fragment13 Ramos C46(1.04)  LDD2192  [7]
 LDCM0576  Fragment14 Ramos C46(1.11)  LDD2193  [7]
 LDCM0579  Fragment20 Ramos C46(0.84)  LDD2194  [7]
 LDCM0580  Fragment21 Ramos C46(1.19)  LDD2195  [7]
 LDCM0582  Fragment23 Ramos C46(0.61)  LDD2196  [7]
 LDCM0578  Fragment27 Ramos C46(1.38)  LDD2197  [7]
 LDCM0586  Fragment28 Ramos C46(0.46)  LDD2198  [7]
 LDCM0588  Fragment30 Ramos C46(1.27)  LDD2199  [7]
 LDCM0589  Fragment31 Ramos C46(1.44)  LDD2200  [7]
 LDCM0590  Fragment32 Ramos C46(0.50)  LDD2201  [7]
 LDCM0468  Fragment33 Ramos C46(1.59)  LDD2202  [7]
 LDCM0596  Fragment38 Ramos C46(0.96)  LDD2203  [7]
 LDCM0566  Fragment4 Ramos C46(0.80)  LDD2184  [7]
 LDCM0610  Fragment52 Ramos C46(1.43)  LDD2204  [7]
 LDCM0614  Fragment56 Ramos C46(1.14)  LDD2205  [7]
 LDCM0569  Fragment7 Ramos C46(0.56)  LDD2186  [7]
 LDCM0571  Fragment9 Ramos C46(1.05)  LDD2188  [7]
 LDCM0022  KB02 Ramos C46(0.52)  LDD2182  [7]
 LDCM0023  KB03 Ramos C46(0.73)  LDD2183  [7]
 LDCM0024  KB05 COLO792 C88(4.08)  LDD3310  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein mab-21-like 2 (MAB21L2) Mab-21 family Q9Y586

References

1 An Activity-Based Oxaziridine Platform for Identifying and Developing Covalent Ligands for Functional Allosteric Methionine Sites: Redox-Dependent Inhibition of Cyclin-Dependent Kinase 4. J Am Chem Soc. 2022 Dec 21;144(50):22890-22901. doi: 10.1021/jacs.2c04039. Epub 2022 Dec 9.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578