Details of the Target
General Information of Target
Target ID | LDTP04650 | |||||
---|---|---|---|---|---|---|
Target Name | Microfibrillar-associated protein 2 (MFAP2) | |||||
Gene Name | MFAP2 | |||||
Gene ID | 4237 | |||||
Synonyms |
MAGP1; Microfibrillar-associated protein 2; MFAP-2; Microfibril-associated glycoprotein 1; MAGP; MAGP-1 |
|||||
3D Structure | ||||||
Sequence |
MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEE
QFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNE VCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSC GSC |
|||||
Target Bioclass |
Other
|
|||||
Family |
MFAP family
|
|||||
Subcellular location |
Secreted, extracellular space, extracellular matrix
|
|||||
Function | Component of the elastin-associated microfibrils. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
DBIA Probe Info |
![]() |
C142(4.38) | LDD3469 | [2] | |
FBPP2 Probe Info |
![]() |
2.26 | LDD0054 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [4] |
LDCM0367 | CL1 | HEK-293T | C169(0.98) | LDD1571 | [5] |
LDCM0370 | CL101 | HEK-293T | C169(0.73) | LDD1574 | [5] |
LDCM0374 | CL105 | HEK-293T | C169(0.87) | LDD1578 | [5] |
LDCM0378 | CL109 | HEK-293T | C169(1.40) | LDD1582 | [5] |
LDCM0383 | CL113 | HEK-293T | C169(0.90) | LDD1587 | [5] |
LDCM0387 | CL117 | HEK-293T | C169(0.82) | LDD1591 | [5] |
LDCM0392 | CL121 | HEK-293T | C169(0.90) | LDD1596 | [5] |
LDCM0396 | CL125 | HEK-293T | C169(0.98) | LDD1600 | [5] |
LDCM0400 | CL13 | HEK-293T | C169(0.75) | LDD1604 | [5] |
LDCM0413 | CL25 | HEK-293T | C169(0.83) | LDD1617 | [5] |
LDCM0426 | CL37 | HEK-293T | C169(0.93) | LDD1630 | [5] |
LDCM0439 | CL49 | HEK-293T | C169(1.12) | LDD1643 | [5] |
LDCM0453 | CL61 | HEK-293T | C169(1.00) | LDD1656 | [5] |
LDCM0466 | CL73 | HEK-293T | C169(0.71) | LDD1669 | [5] |
LDCM0479 | CL85 | HEK-293T | C169(0.98) | LDD1682 | [5] |
LDCM0492 | CL97 | HEK-293T | C169(0.95) | LDD1695 | [5] |
LDCM0022 | KB02 | A204 | C84(1.67); C142(1.77) | LDD2252 | [2] |
LDCM0023 | KB03 | A204 | C84(1.81) | LDD2669 | [2] |
LDCM0024 | KB05 | TE4 | C142(4.38) | LDD3469 | [2] |
LDCM0008 | Tranylcypromine | SH-SY5Y | 2.26 | LDD0054 | [3] |
The Interaction Atlas With This Target
References