Details of the Target
General Information of Target
| Target ID | LDTP04403 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-related protein Rab-27A (RAB27A) | |||||
| Gene Name | RAB27A | |||||
| Gene ID | 5873 | |||||
| Synonyms |
RAB27; Ras-related protein Rab-27A; Rab-27; EC 3.6.5.2; GTP-binding protein Ram |
|||||
| 3D Structure | ||||||
| Sequence |
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDG
ATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH AYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDL IMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rab family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C123(1.11) | LDD0304 | [2] | |
|
BTD Probe Info |
![]() |
C188(1.07) | LDD2129 | [3] | |
|
HPAP Probe Info |
![]() |
3.01 | LDD0063 | [4] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0025 | [5] | |
|
JW-RF-010 Probe Info |
![]() |
N.A. | LDD0026 | [5] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [6] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [6] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C188(1.17) | LDD2187 | [7] |
| LDCM0573 | Fragment11 | Ramos | C188(0.04) | LDD2190 | [7] |
| LDCM0575 | Fragment13 | Ramos | C188(1.04) | LDD2192 | [7] |
| LDCM0576 | Fragment14 | Ramos | C188(1.78) | LDD2193 | [7] |
| LDCM0580 | Fragment21 | Ramos | C188(0.95) | LDD2195 | [7] |
| LDCM0582 | Fragment23 | Ramos | C188(1.79) | LDD2196 | [7] |
| LDCM0578 | Fragment27 | Ramos | C188(0.90) | LDD2197 | [7] |
| LDCM0586 | Fragment28 | Ramos | C188(0.80) | LDD2198 | [7] |
| LDCM0588 | Fragment30 | Ramos | C188(2.36) | LDD2199 | [7] |
| LDCM0589 | Fragment31 | Ramos | C188(1.01) | LDD2200 | [7] |
| LDCM0590 | Fragment32 | Ramos | C188(2.65) | LDD2201 | [7] |
| LDCM0468 | Fragment33 | Ramos | C188(1.50) | LDD2202 | [7] |
| LDCM0596 | Fragment38 | Ramos | C188(2.18) | LDD2203 | [7] |
| LDCM0566 | Fragment4 | Ramos | C188(2.04) | LDD2184 | [7] |
| LDCM0610 | Fragment52 | Ramos | C188(3.18) | LDD2204 | [7] |
| LDCM0614 | Fragment56 | Ramos | C188(1.34) | LDD2205 | [7] |
| LDCM0569 | Fragment7 | Ramos | C188(2.49) | LDD2186 | [7] |
| LDCM0022 | KB02 | Ramos | C188(3.78) | LDD2182 | [7] |
| LDCM0023 | KB03 | Ramos | C188(1.91) | LDD2183 | [7] |
| LDCM0024 | KB05 | T cell | C123, C131(5.14) | LDD1709 | [8] |
| LDCM0536 | Nucleophilic fragment 31 | MDA-MB-231 | C188(1.07) | LDD2129 | [3] |
| LDCM0546 | Nucleophilic fragment 40 | MDA-MB-231 | C188(0.70) | LDD2140 | [3] |
| LDCM0014 | Panhematin | K562 | 3.01 | LDD0063 | [4] |
| LDCM0131 | RA190 | MM1.R | C123(1.11) | LDD0304 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Synaptotagmin-like protein 4 (SYTL4) | . | Q96C24 | |||
Other
References









