Details of the Target

General Information of Target

Target ID LDTP04255
Target Name Transmembrane ascorbate-dependent reductase CYB561 (CYB561)
Gene Name CYB561
Gene ID 1534
Synonyms
Transmembrane ascorbate-dependent reductase CYB561; EC 7.2.1.-; Cytochrome b-561; Cytochrome b561
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEGGAAAATPTALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIG
LIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSL
HSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLK
EALLFNLGGKYSAFEPEGVLANVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFK
TLTEGDSPGSQ
Target Bioclass
Enzyme
Subcellular location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane
Function
Transmembrane reductase that uses ascorbate as an electron donor in the cytoplasm and transfers electrons across membranes to reduce monodehydro-L-ascorbate radical in the lumen of secretory vesicles. It is therefore involved the regeneration and homeostasis within secretory vesicles of ascorbate which in turn provides reducing equivalents needed to support the activity of intravesicular enzymes.
Uniprot ID
P49447
Ensemble ID
ENST00000360793.8
HGNC ID
HGNC:2571

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FBPP2
 Probe Info  		2.02  LDD0054  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0008  Tranylcypromine SH-SY5Y 2.02  LDD0054  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT) CDP-alcohol phosphatidyltransferase class-I family O14735
Aspartate--tRNA ligase, mitochondrial (DARS2) Class-II aminoacyl-tRNA synthetase family Q6PI48
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Stearoyl-CoA desaturase (SCD) Fatty acid desaturase type 1 family O00767
Glutathione hydrolase 7 (GGT7) Gamma-glutamyltransferase family Q9UJ14
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Heme oxygenase 1 (HMOX1) Heme oxygenase family P09601
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
E3 ubiquitin-protein ligase RNF5 (RNF5) RNF5 family Q99942
GTPase IMAP family member 5 (GIMAP5) AIG1/Toc34/Toc159-like paraseptin GTPase family Q96F15
Ubiquitin-conjugating enzyme E2 J1 (UBE2J1) Ubiquitin-conjugating enzyme family Q9Y385
Peptidyl-prolyl cis-trans isomerase FKBP8 (FKBP8) . Q14318
Transporter and channel
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sodium-coupled neutral amino acid transporter 7 (SLC38A7) Amino acid/polyamine transporter 2 family Q9NVC3
Bestrophin-2 (BEST2) Anion channel-forming bestrophin family Q8NFU1
Transmembrane 4 L6 family member 18 (TM4SF18) L6 tetraspanin family Q96CE8
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Thiamine transporter 2 (SLC19A3) Reduced folate carrier (RFC) transporter (TC 2.A.48) family Q9BZV2
Small integral membrane protein 1 (SMIM1) SMIM1 family B2RUZ4
Syntaxin-3 (STX3) Syntaxin family Q13277
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Transmembrane protein 179B (TMEM179B) TMEM179 family Q7Z7N9
Transmembrane protein 242 (TMEM242) TMEM242 family Q9NWH2
Vesicle-associated membrane protein-associated protein A (VAPA) VAMP-associated protein (VAP) (TC 9.B.17) family Q9P0L0
Vesicle-associated membrane protein-associated protein B/C (VAPB) VAMP-associated protein (VAP) (TC 9.B.17) family O95292
Zinc transporter ZIP1 (SLC39A1) ZIP transporter (TC 2.A.5) family Q9NY26
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Proteolipid protein 2 (PLP2) . Q04941
Synaptojanin-2-binding protein (SYNJ2BP) . P57105
Transmembrane protein 65 (TMEM65) . Q6PI78
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lysophosphatidic acid receptor 3 (LPAR3) G-protein coupled receptor 1 family Q9UBY5
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CKLF-like MARVEL transmembrane domain-containing protein 2 (CMTM2) Chemokine-like factor family Q8TAZ6
Ectodysplasin-A (EDA) Tumor necrosis factor family Q92838
Other
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BET1 homolog (BET1) BET1 family O15155
Claudin-9 (CLDN9) Claudin family O95484
Ephrin-A5 (EFNA5) Ephrin family P52803
Ergosterol biosynthetic protein 28 homolog (ERG28) ERG28 family Q9UKR5
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Golgi SNAP receptor complex member 2 (GOSR2) GOSR2 family O14653
ORM1-like protein 2 (ORMDL2) ORM family Q53FV1
Stress-associated endoplasmic reticulum protein 2 (SERP2) RAMP4 family Q8N6R1
Vesicle transport protein SEC20 (BNIP1) SEC20 family Q12981
Vesicle-trafficking protein SEC22a (SEC22A) Synaptobrevin family Q96IW7
Transmembrane protein 11, mitochondrial (TMEM11) TMEM11 family P17152
Bcl-2-interacting killer (BIK) . Q13323
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3

References

1 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580