Details of the Target
General Information of Target
| Target ID | LDTP04172 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tissue factor pathway inhibitor 2 (TFPI2) | |||||
| Gene Name | TFPI2 | |||||
| Gene ID | 7980 | |||||
| Synonyms |
Tissue factor pathway inhibitor 2; TFPI-2; Placental protein 5; PP5 |
|||||
| 3D Structure | ||||||
| Sequence |
MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQS
CRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSM TCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRY RTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | May play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HGC27 | SNV: p.C86Y | . | |||
| MFE319 | SNV: p.G71D | DBIA Probe Info | |||
| OVK18 | Deletion: p.L7WfsTer10 | DBIA Probe Info | |||
| RKO | SNV: p.N137K | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
![]() |
4.46 | LDD0054 | [1] | |
|
DBIA Probe Info |
![]() |
C183(1.47); C191(1.47); C145(1.26); C149(1.26) | LDD0078 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0020 | ARS-1620 | HCC44 | C183(1.47); C191(1.47); C145(1.26); C149(1.26) | LDD0078 | [2] |
| LDCM0022 | KB02 | 42-MG-BA | C61(1.41) | LDD2244 | [4] |
| LDCM0023 | KB03 | 42-MG-BA | C61(1.95) | LDD2661 | [4] |
| LDCM0024 | KB05 | COLO792 | C158(5.87) | LDD3310 | [4] |
| LDCM0008 | Tranylcypromine | SH-SY5Y | 4.46 | LDD0054 | [1] |
References



