General Information of Target

Target ID LDTP04075
Target Name Mitogen-activated protein kinase 8 (MAPK8)
Gene Name MAPK8
Gene ID 5599
Synonyms
JNK1; PRKM8; SAPK1; SAPK1C; Mitogen-activated protein kinase 8; MAP kinase 8; MAPK 8; EC 2.7.11.24; JNK-46; Stress-activated protein kinase 1c; SAPK1c; Stress-activated protein kinase JNK1; c-Jun N-terminal kinase 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Subcellular location
Cytoplasm
Function
Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK8/JNK1. In turn, MAPK8/JNK1 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN, JDP2 and ATF2 and thus regulates AP-1 transcriptional activity. Phosphorylates the replication licensing factor CDT1, inhibiting the interaction between CDT1 and the histone H4 acetylase HBO1 to replication origins. Loss of this interaction abrogates the acetylation required for replication initiation. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including p53/TP53 and Yes-associates protein YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Contributes to the survival of erythroid cells by phosphorylating the antagonist of cell death BAD upon EPO stimulation. Mediates starvation-induced BCL2 phosphorylation, BCL2 dissociation from BECN1, and thus activation of autophagy. Phosphorylates STMN2 and hence regulates microtubule dynamics, controlling neurite elongation in cortical neurons. In the developing brain, through its cytoplasmic activity on STMN2, negatively regulates the rate of exit from multipolar stage and of radial migration from the ventricular zone. Phosphorylates several other substrates including heat shock factor protein 4 (HSF4), the deacetylase SIRT1, ELK1, or the E3 ligase ITCH. Phosphorylates the CLOCK-BMAL1 heterodimer and plays a role in the regulation of the circadian clock. Phosphorylates the heat shock transcription factor HSF1, suppressing HSF1-induced transcriptional activity. Phosphorylates POU5F1, which results in the inhibition of POU5F1's transcriptional activity and enhances its proteasomal degradation. Phosphorylates JUND and this phosphorylation is inhibited in the presence of MEN1. In neurons, phosphorylates SYT4 which captures neuronal dense core vesicles at synapses. Phosphorylates EIF4ENIF1/4-ET in response to oxidative stress, promoting P-body assembly. Phosphorylates SIRT6 in response to oxidative stress, stimulating its mono-ADP-ribosyltransferase activity. Phosphorylates NLRP3, promoting assembly of the NLRP3 inflammasome.; JNK1 isoforms display different binding patterns: beta-1 preferentially binds to c-Jun, whereas alpha-1, alpha-2, and beta-2 have a similar low level of binding to both c-Jun or ATF2. However, there is no correlation between binding and phosphorylation, which is achieved at about the same efficiency by all isoforms.
TTD ID
T40097
Uniprot ID
P45983
DrugMap ID
TT0K6EO
Ensemble ID
ENST00000360332.7
HGNC ID
HGNC:6881
ChEMBL ID
CHEMBL2276

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CHL1 SNV: p.A409S DBIA    Probe Info 
HSC3 SNV: p.D103H .
KELLY SNV: p.A282D DBIA    Probe Info 
NUGC3 SNV: p.G177Ter .
SW1271 SNV: p.D277G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
15.00  LDD0402  [1]
TH211
 Probe Info 
Y259(9.81)  LDD0257  [2]
DBIA
 Probe Info 
C175(1.47)  LDD3325  [3]
4-Iodoacetamidophenylacetylene
 Probe Info 
C137(0.00); C245(0.00); C41(0.00)  LDD0038  [4]
IA-alkyne
 Probe Info 
C245(0.00); C41(0.00)  LDD0036  [4]
IPIAA_L
 Probe Info 
N.A.  LDD0031  [5]
Lodoacetamide azide
 Probe Info 
C137(0.00); C245(0.00); C41(0.00)  LDD0037  [4]
IPM
 Probe Info 
N.A.  LDD2156  [6]
W1
 Probe Info 
N.A.  LDD0236  [7]
AOyne
 Probe Info 
15.00  LDD0443  [8]
NAIA_5
 Probe Info 
N.A.  LDD2223  [9]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DFG-out-4
 Probe Info 
6.30  LDD0075  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 12.20  LDD0403  [1]
 LDCM0632  CL-Sc Hep-G2 C245(1.26)  LDD2227  [9]
 LDCM0017  DFG-out-2 A431 6.30  LDD0075  [10]
 LDCM0625  F8 Ramos C245(1.36)  LDD2187  [11]
 LDCM0573  Fragment11 Ramos C245(2.27)  LDD2190  [11]
 LDCM0575  Fragment13 Ramos C245(1.01)  LDD2192  [11]
 LDCM0576  Fragment14 Ramos C245(0.89)  LDD2193  [11]
 LDCM0580  Fragment21 Ramos C245(0.87)  LDD2195  [11]
 LDCM0582  Fragment23 Ramos C245(8.50)  LDD2196  [11]
 LDCM0578  Fragment27 Ramos C245(0.41)  LDD2197  [11]
 LDCM0586  Fragment28 Ramos C245(0.89)  LDD2198  [11]
 LDCM0588  Fragment30 Ramos C245(0.82)  LDD2199  [11]
 LDCM0589  Fragment31 Ramos C245(0.82)  LDD2200  [11]
 LDCM0468  Fragment33 Ramos C245(0.78)  LDD2202  [11]
 LDCM0596  Fragment38 Ramos C245(0.60)  LDD2203  [11]
 LDCM0566  Fragment4 Ramos C245(1.56)  LDD2184  [11]
 LDCM0614  Fragment56 Ramos C245(0.60)  LDD2205  [11]
 LDCM0022  KB02 Ramos C245(2.54)  LDD2182  [11]
 LDCM0023  KB03 42-MG-BA C283(1.97)  LDD2661  [3]
 LDCM0024  KB05 UACC257 C175(1.47)  LDD3325  [3]
 LDCM0112  W16 Hep-G2 C245(1.20)  LDD0239  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4) STE Ser/Thr protein kinase family P45985
Dual specificity protein phosphatase 10 (DUSP10) Protein-tyrosine phosphatase family Q9Y6W6
Dual specificity protein phosphatase 16 (DUSP16) Protein-tyrosine phosphatase family Q9BY84
E3 ubiquitin-protein ligase CBL (CBL) . P22681
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription factor Jun (JUN) BZIP family P05412
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone H2AX (H2AX) Histone H2A family P16104
C-Jun-amino-terminal kinase-interacting protein 1 (MAPK8IP1) JIP scaffold family Q9UQF2
Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1) PI3K p85 subunit family P27986
Regulatory-associated protein of mTOR (RPTOR) WD repeat RAPTOR family Q8N122

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Minocycline Small molecular drug DB01017
Tamoxifen Small molecular drug DB00675
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Nkp-1339 Small molecular drug D08SIT
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cor-d Small molecular drug DOJ6D9
Investigative
Click To Hide/Show 31 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
2,6-dihydroanthra/1,9-cd/Pyrazol-6-one Small molecular drug D02PVB
2-(2-(Butylamino)Pyrimidin-4-ylamino)Benzoic Acid Small molecular drug D03UUO
2-(2-(Pentyloxy)Pyrimidin-4-ylamino)Benzoic Acid Small molecular drug D0SV1F
2-(2-(Phenylamino)Pyrimidin-4-ylamino)Benzamide Small molecular drug D08UVX
2-(2-butoxypyrimidin-4-ylamino)Benzoic Acid Small molecular drug D08IOV
2-(2-phenoxypyrimidin-4-ylamino)Benzoic Acid Small molecular drug D07HNL
2-(2-propoxypyrimidin-4-ylamino)Benzoic Acid Small molecular drug D01HCO
2-(2-sec-butoxypyrimidin-4-ylamino)Benzoic Acid Small molecular drug D0KB8D
4,5,6,7-tetrabromo-1h-benzo[D][1,2,3]Triazole Small molecular drug D0O1YH
Aminopyridine Deriv. 2 Small molecular drug D00HVA
As-601245 Small molecular drug D04QCF
Bisindolylmaleimide-i Small molecular drug D0TO6S
Ci-1040 Small molecular drug D0B9BU
Jnk-in-8 Small molecular drug D0VJ2S
Kn-62 Small molecular drug D0N6ES
Kt-5720 Small molecular drug D0G2VC
N-(4-amino-5-cyano-6-ethoxypyridin-2-yl)Acetamide Small molecular drug D0Q3NG
N-(4-amino-5-cyano-6-phenylpyridin-2-yl)Acetamide Small molecular drug D0S7IE
N-(4-amino-6-butoxy-5-cyanopyridin-2-yl)Acetamide Small molecular drug D0F5BY
N-(6-ethoxypyridin-2-yl)Acetamide Small molecular drug D0E8KF
Nm-pp1 Small molecular drug D0GT8N
Phylomers Small molecular drug D0Y5BR
Pyrazolanthrone Small molecular drug DB01782
Ro-316233 Small molecular drug D0L8HO
Ro31-8220 Small molecular drug D0M5FF
2-({2-[(3-hydroxyphenyl)Amino]Pyrimidin-4-yl}Amino)Benzamide . DB07268
2-fluoro-6-{[2-({2-methoxy-4-[(Methylsulfonyl)Methyl]Phenyl}Amino)-7h-pyrrolo[23-d]Pyrimidin-4-yl]Amino}Benzamide . DB07845
5-cyano-n-(25-dimethoxybenzyl)-6-ethoxypyridine-2-carboxamide . DB07276
6-chloro-9-hydroxy-13-dimethyl-19-dihydro-4h-pyrazolo[34-b]Quinolin-4-one . DB07218
N-(4-amino-5-cyano-6-ethoxypyridin-2-yl)-2-(4-bromo-25-dimethoxyphenyl)Acetamide . DB07272
Staurosporinone . D0GB4V
Patented
Click To Hide/Show 43 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid25991433-compound-o3 Peptide D0Q4WA
7-azaindole Derivative 1 Small molecular drug D05SJB
7-azaindole Derivative 2 Small molecular drug D0VR1O
7-azaindole Derivative 3 Small molecular drug D0T6IZ
7-azaindole Derivative 5 Small molecular drug D07KMK
Pmid25991433-compound-a1 Small molecular drug D0H4HD
Pmid25991433-compound-a10 Small molecular drug D03HEK
Pmid25991433-compound-a11 Small molecular drug D09YEH
Pmid25991433-compound-a2 Small molecular drug D0RV2Z
Pmid25991433-compound-a3 Small molecular drug D0VE3Y
Pmid25991433-compound-a5 Small molecular drug D0V1CB
Pmid25991433-compound-a6 Small molecular drug D04JUD
Pmid25991433-compound-a7 Small molecular drug D0S1OV
Pmid25991433-compound-a8 Small molecular drug D0AM2B
Pmid25991433-compound-a9 Small molecular drug D0S3AP
Pmid25991433-compound-d1 Small molecular drug D0B4IH
Pmid25991433-compound-d2 Small molecular drug D07JQX
Pmid25991433-compound-e1 Small molecular drug D09QKG
Pmid25991433-compound-e2 Small molecular drug D0TK0L
Pmid25991433-compound-e3 Small molecular drug D0Y4HR
Pmid25991433-compound-e4 Small molecular drug D0XH9K
Pmid25991433-compound-e5 Small molecular drug D06WAW
Pmid25991433-compound-eb Small molecular drug D0MW7D
Pmid25991433-compound-f2 Small molecular drug D06JRV
Pmid25991433-compound-g1 Small molecular drug D0J8DR
Pmid25991433-compound-g2 Small molecular drug D0I3NS
Pmid25991433-compound-g4 Small molecular drug D0EA5P
Pmid25991433-compound-g5 Small molecular drug D0V0WT
Pmid25991433-compound-h1 Small molecular drug D0XB1S
Pmid25991433-compound-h2 Small molecular drug D01GSU
Pmid25991433-compound-h3 Small molecular drug D00JGN
Pmid25991433-compound-j2 Small molecular drug D0RQ8Q
Pmid25991433-compound-j3 Small molecular drug D08JOC
Pmid25991433-compound-j5 Small molecular drug D0ZU8L
Pmid25991433-compound-k1 Small molecular drug D0Y7QW
Pmid25991433-compound-k2 Small molecular drug D0EA6L
Pmid25991433-compound-l1 Small molecular drug D0Q8CR
Pmid25991433-compound-n1 Small molecular drug D0ID4H
Pmid25991433-compound-n3 Small molecular drug D08JIS
Pmid25991433-compound-p1 Small molecular drug D0L2MS
Pmid25991433-compound-p4 Small molecular drug D0X2SG
Pmid25991433-compound-p5 Small molecular drug D0W8BL
Pmid25991433-compound-p6 Small molecular drug D08DNZ

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
5 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
6 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
7 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
8 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
9 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
10 Affinity-based probes based on type II kinase inhibitors. J Am Chem Soc. 2012 Nov 21;134(46):19017-25. doi: 10.1021/ja306035v. Epub 2012 Nov 6.
11 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578