General Information of Target

Target ID LDTP03736
Target Name Prostaglandin G/H synthase 2 (PTGS2)
Gene Name PTGS2
Gene ID 5743
Synonyms
COX2; Prostaglandin G/H synthase 2; EC 1.14.99.1; Cyclooxygenase-2; COX-2; PHS II; Prostaglandin H2 synthase 2; PGH synthase 2; PGHS-2; Prostaglandin-endoperoxide synthase 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
Target Type
Successful
Target Bioclass
Enzyme
Family
Prostaglandin G/H synthase family
Subcellular location
Microsome membrane
Function
Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20:4(n-6)), with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates AA to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide prostaglandin H2 (PGH2), the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons. Similarly catalyzes successive cyclooxygenation and peroxidation of dihomo-gamma-linoleate (DGLA, C20:3(n-6)) and eicosapentaenoate (EPA, C20:5(n-3)) to corresponding PGH1 and PGH3, the precursors of 1- and 3-series prostaglandins. In an alternative pathway of prostanoid biosynthesis, converts 2-arachidonoyl lysophopholipids to prostanoid lysophopholipids, which are then hydrolyzed by intracellular phospholipases to release free prostanoids. Metabolizes 2-arachidonoyl glycerol yielding the glyceryl ester of PGH2, a process that can contribute to pain response. Generates lipid mediators from n-3 and n-6 polyunsaturated fatty acids (PUFAs) via a lipoxygenase-type mechanism. Oxygenates PUFAs to hydroperoxy compounds and then reduces them to corresponding alcohols. Plays a role in the generation of resolution phase interaction products (resolvins) during both sterile and infectious inflammation. Metabolizes docosahexaenoate (DHA, C22:6(n-3)) to 17R-HDHA, a precursor of the D-series resolvins (RvDs). As a component of the biosynthetic pathway of E-series resolvins (RvEs), converts eicosapentaenoate (EPA, C20:5(n-3)) primarily to 18S-HEPE that is further metabolized by ALOX5 and LTA4H to generate 18S-RvE1 and 18S-RvE2. In vascular endothelial cells, converts docosapentaenoate (DPA, C22:5(n-3)) to 13R-HDPA, a precursor for 13-series resolvins (RvTs) shown to activate macrophage phagocytosis during bacterial infection. In activated leukocytes, contributes to oxygenation of hydroxyeicosatetraenoates (HETE) to diHETES (5,15-diHETE and 5,11-diHETE). Can also use linoleate (LA, (9Z,12Z)-octadecadienoate, C18:2(n-6)) as substrate and produce hydroxyoctadecadienoates (HODEs) in a regio- and stereospecific manner, being (9R)-HODE ((9R)-hydroxy-(10E,12Z)-octadecadienoate) and (13S)-HODE ((13S)-hydroxy-(9Z,11E)-octadecadienoate) its major products. During neuroinflammation, plays a role in neuronal secretion of specialized preresolving mediators (SPMs) 15R-lipoxin A4 that regulates phagocytic microglia.
TTD ID
T66665
Uniprot ID
P35354
DrugMap ID
TTVKILB
Ensemble ID
ENST00000367468.10
HGNC ID
HGNC:9605
ChEMBL ID
CHEMBL230

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C145(1.89); C561(1.81)  LDD3316  [1]
Acrolein
 Probe Info 
N.A.  LDD0227  [2]
IA-alkyne
 Probe Info 
N.A.  LDD0166  [3]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-1
 Probe Info 
N.A.  LDD0136  [4]
A-DA
 Probe Info 
3.73  LDD0140  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0080  Flurbiprofen A-549 3.73  LDD0140  [5]
 LDCM0022  KB02 IGR37 C145(1.23)  LDD2480  [1]
 LDCM0023  KB03 IGR37 C145(1.91)  LDD2897  [1]
 LDCM0024  KB05 MEL167 C145(1.89); C561(1.81)  LDD3316  [1]
 LDCM0109  NEM HeLa N.A.  LDD0227  [2]
 LDCM0084  Ro 48-8071 A-549 2.49  LDD0144  [5]
 LDCM0081  Rofecoxib A-549 3.58  LDD0141  [5]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved
Click To Hide/Show 84 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Aldesleukin BiotechDrug DB00041
Aceclofenac Small molecular drug DB06736
Acetaminophen Small molecular drug DB00316
Acetylsalicylic Acid Small molecular drug DB00945
Aminosalicylic Acid Small molecular drug D01WJL
Aminosalicylic Acid Small molecular drug DB00233
Antipyrine Small molecular drug DB01435
Antrafenine Small molecular drug DB01419
Balsalazide Small molecular drug DB01014
Bromfenac Small molecular drug DB00963
Bumetanide Small molecular drug DB00887
Cannabidiol Small molecular drug DB09061
Capsaicin Small molecular drug DB06774
Carprofen Small molecular drug D0IT2X
Celecoxib Small molecular drug D03RTS
Choline Magnesium Trisalicylate Small molecular drug DB01401
Cisplatin Small molecular drug DB00515
Clodronic Acid Small molecular drug DB00720
Dapsone Small molecular drug DB00250
Desmopressin Small molecular drug DB00035
Dexibuprofen Small molecular drug DB09213
Diclofenac Small molecular drug DB00586
Diflunisal Small molecular drug D08LFZ
Drospirenone Small molecular drug DB01395
Eicosapentaenoic Acid/Docosa-hexaenoic Acid Small molecular drug D0Q5XX
Etodolac Small molecular drug D0N1WU
Etoposide Small molecular drug DB00773
Etoricoxib Small molecular drug D09MGR
Fenbufen Small molecular drug D06LHG
Fenoprofen Small molecular drug DB00573
Flufenamic Acid Small molecular drug D0B2WJ
Flufenamic Acid Small molecular drug DB02266
Flurbiprofen Small molecular drug D0A1PX
Ibuprofen Small molecular drug D0R1QE
Icosapent Small molecular drug DB00159
Indomethacin Small molecular drug D0R1RS
Ketoprofen Small molecular drug D0W9WF
Ketorolac Small molecular drug DB00465
Lenalidomide Small molecular drug DB00480
Lornoxicam Small molecular drug DB06725
Loxoprofen Small molecular drug DB09212
Lumiracoxib Small molecular drug D04YMH
Meclofenamate Sodium Small molecular drug D0MN9K
Meclofenamic Acid Small molecular drug DB00939
Mefenamic Acid Small molecular drug D05FTJ
Meloxicam Small molecular drug D0G7FJ
Mesalazine Small molecular drug DB00244
Nabumetone Small molecular drug D05CKR
Naproxen Small molecular drug D0DJ1B
Nepafenac Small molecular drug DB06802
Niflumic Acid Small molecular drug D00HGB
Oxaprozin Small molecular drug DB00991
Parecoxib Small molecular drug DB08439
Phenylbutazone Small molecular drug D07VHR
Piroxicam Small molecular drug DB00554
Pomalidomide Small molecular drug DB08910
Risedronic Acid Small molecular drug DB00884
Rofecoxib Small molecular drug D05VLS
Salicylic Acid Small molecular drug DB00936
Salsalate Small molecular drug DB01399
Sapropterin Small molecular drug DB00360
Sulfasalazine Small molecular drug DB00795
Sulindac Small molecular drug DB00605
Suprofen Small molecular drug DB00870
Tafluprost Small molecular drug DB08819
Tenoxicam Small molecular drug D0I6IB
Thalidomide Small molecular drug DB01041
Tiaprofenic Acid Small molecular drug D0S7VO
Tolmetin Small molecular drug D09BHB
Triamcinolone Small molecular drug DB00620
Valdecoxib Small molecular drug D0L6DA
Acemetacin . DB13783
Alclofenac . DB13167
Bendazac . DB13501
Bufexamac . DB13346
Dexketoprofen . DB09214
Dipyrithione . DB11327
Fish Oil . DB13961
Glycol Salicylate . DB11323
Menthyl Salicylate . DB11201
Omega-3 Fatty Acids . DB11133
Phenyl Salicylate . DB11071
Tolfenamic Acid . DB09216
Trolamine Salicylate . DB11079
Phase 4
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Imrecoxib Small molecular drug D0AL8M
Phase 3
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cg-100649 Small molecular drug D0W2CX
Curcumin Small molecular drug D07SDQ
Darbufelone Small molecular drug D0AL8T
Thermoprofen . D0C4DZ
Phase 2
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cimicoxib Small molecular drug D0U8OD
Fk-3311 Small molecular drug D0Z9YW
Sc-75416 . D02DYU
Phase 1
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ca102n Small molecular drug DTYP21
Rwj-67657 Small molecular drug D06OZJ
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(S)-flurbiprofen Small molecular drug D0G2IC
Investigative
Click To Hide/Show 143 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(11h-dibenzo[B,E][1,4]Dioxepin-2-yl)-acetic Acid Small molecular drug D0N0YS
(11h-dibenzo[B,E][1,4]Dioxepin-7-yl)-acetic Acid Small molecular drug D0X5RR
(11h-dibenzo[B,E][1,4]Dioxepin-8-yl)-acetic Acid Small molecular drug D0GF9J
(E)-2-(4-(Methylsulfonyl)Styryl)Furan Small molecular drug D0UD5X
(E)-2-(4-(Methylsulfonyl)Styryl)Thiophene Small molecular drug D08HRA
(E)-3-(4-(Methylsulfonyl)Styryl)Thiophene Small molecular drug D03XZJ
(E)-4-(2-(Furan-2-yl)Vinyl)Benzenesulfonamide Small molecular drug D02FYN
(E)-4-(2-(Thiophen-2-yl)Vinyl)Benzenesulfonamide Small molecular drug D02VXW
(E)-4-(2-(Thiophen-3-yl)Vinyl)Benzenesulfonamide Small molecular drug D0N0GX
(R)-2-(4-isobutyl-phenyl)-n-phenyl-propionamide Small molecular drug D0A4LW
(Z)-2'-des-methyl Sulindac Sulfide Small molecular drug D0D6UC
1,2-dihydro-3-(2,3,4-trimethoxyphenyl)Naphthalene Small molecular drug D0OX0B
1,3-bis(Nitrooxy)Propan-2-yl 2-acetoxybenzoate Small molecular drug D0K4QW
1-(2-hydroxyphenyl)-3-p-tolylprop-2-en-1-one Small molecular drug D05ZDQ
1-(4-(Methylsulfonyl)Phenyl)-1h-indole Small molecular drug D07AFA
1-(4-(Methylsulfonyl)Phenyl)-1h-pyrrole Small molecular drug D00TKO
1-(4-(Methylsulfonyl)Phenyl)-3-p-tolylurea Small molecular drug D0T7BP
1-(4-(Methylsulfonyl)Phenyl)-3-phenylurea Small molecular drug D0LL9E
1-(4-aminosulfonylphenyl)-2-(2-pyridyl)Acetylene Small molecular drug D0V9AU
1-phenylsulfonamide-3-trifluoromethyl-5-parabromophenylpyrazole Small molecular drug DB03477
2'-hydroxy-3,4,5-trimethoxychalcone Small molecular drug D0Q4CT
2'-hydroxychalcone Small molecular drug D0S9YA
2,3-dimethoxy-2'-hydroxychalcone Small molecular drug D0LB6L
2,4'-dimethoxy-5,3'-di-(2-propenyl)-biphenyl Small molecular drug D01JYF
2,4'-dimethoxy-5,3'-dipropyl-biphenyl Small molecular drug D0NB0I
2,4-dimethoxy-2'-hydroxychalcone Small molecular drug D0C6WN
2,6-dihydroxy-1,7-dimethoxyxanthone Small molecular drug D0S7LD
2-(2,3,4-trimethoxyphenyl)-1h-indene Small molecular drug D02CCB
2-(2-(2,6-dimethylphenylamino)Phenyl)Acetic Acid Small molecular drug D0U0YE
2-(3-phenyl-propyl)-1,2-dihydro-indazol-3-one Small molecular drug D0L4TM
2-(4-(Methylsulfonyl)Phenyl)-3-phenylquinoline Small molecular drug D0V2QP
2-(4-(Methylsulfonyl)Phenyl)Pyridine Small molecular drug D0H4BT
2-(N-(2-ffuorophenyl)Pyrrol-3-yl) Acetic Acid Small molecular drug D02FGY
2-(N-(2-fluorophenyl)Pyrrol-2-yl) Acetic Acid Small molecular drug D07STC
2-(P-methylsulfonylbenzoyl)Furan Small molecular drug D00VBX
2-benzyl-1,2-dihydro-indazol-3-one Small molecular drug D0J7YU
2-furan-2-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0SJ3W
2-methyl-1,2-dihydro-indazol-3-one Small molecular drug D0U8CM
2-naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0X6SA
2-phenethyl-1,2-dihydro-indazol-3-one Small molecular drug D06HUQ
2-phenyl-1,2-dihydro-indazol-3-one Small molecular drug D0S0PB
3 Beta-o-acetyloleanolic Acid Small molecular drug D0ZI8Y
3,4-dibenzyloxy-2'-hydroxychalcone Small molecular drug D0U1UP
3,4-dihydroxyxanthone Small molecular drug D0FQ3N
3-(4-methanesulfonyl-phenyl)-1-phenyl-propynone Small molecular drug D09HWQ
3-benzyloxy-4-methoxy-2'-hydroxychalcone Small molecular drug D0P9BG
3-bromo-2'-hydroxy-4-methoxychalcone Small molecular drug D00LWQ
4,5-bis(4-chlorophenyl)-1,2-selenazole Small molecular drug D0E5MK
4,5-bis(4-chlorophenyl)Isothiazole Small molecular drug D01VRB
4,5-bis(4-methoxyphenyl)-1,2-selenazole Small molecular drug D0D0JE
4,5-bis(4-methoxyphenyl)-3h-1,2-dithiol-3-one Small molecular drug D0X4LI
4,5-bis(4-methoxyphenyl)Isothiazole Small molecular drug D0F0JU
4-((4-methoxyphenyl)Diazenyl)Benzenesulfonamide Small molecular drug D0Z1WF
4-(3-hydroxy-benzylideneamino)-benzenesulfonamide Small molecular drug D0J1AW
4-(3-methoxy-benzylideneamino)-benzenesulfonamide Small molecular drug D02FEF
4-(3-nitro-benzylideneamino)-benzenesulfonamide Small molecular drug D0JT8Y
4-(4-chlorophenyl)-5-p-tolyl-1,2-selenazole Small molecular drug D09MDB
4-(4-fluoro-benzylideneamino)-benzenesulfonamide Small molecular drug D0X6RO
4-(4-fluoro-phenyliminomethyl)-benzenesulfonamide Small molecular drug D0Y9ZO
4-(4-methoxy-benzylideneamino)-benzenesulfonamide Small molecular drug D07QIU
4-(4-methyl-benzylideneamino)-benzenesulfonamide Small molecular drug D0F3UR
4-(4-methyl-phenyliminomethyl)-benzenesulfonamide Small molecular drug D0T2SD
4-(4-nitro-benzylideneamino)-benzenesulfonamide Small molecular drug D03FXI
4-(Benzylideneamino)Benzenesulfonamide Small molecular drug D0S2II
4-amino-n-(4-chlorophenyl)Benzenesulfonamide Small molecular drug D02DYG
4-amino-n-(4-iodophenyl)Benzenesulfonamide Small molecular drug D06BHC
4-benzyloxy-2'-hydroxychalcone Small molecular drug D05UPM
4-fluoro-n-(4-(Methylsulfonyl)Phenyl)Aniline Small molecular drug D0JQ3X
4-phenyliminomethyl-benzenesulfonamide Small molecular drug D09DMR
5,3'-dipropyl-biphenyl-2,4'-diol Small molecular drug D0R6ZC
5-(2-imidazol-1-yl-ethyl)-7,8-dihydro-quinoline Small molecular drug D04ZGF
5-(4-chlorophenyl)-4-p-tolyl-1,2-selenazole Small molecular drug D08RYB
5-(4-methoxyphenyl)-4-p-tolyl-1,2-selenazole Small molecular drug D07RTV
5-ethyl-3,4-diphenyl-isoxazole Small molecular drug D06WML
5-methoxy-2-(4-(Methylsulfonyl)Phenyl)-1h-indole Small molecular drug D0P4QS
5-methyl-3,4-diphenyl-isoxazole Small molecular drug D04YPP
5-phenyl-pentanoic Acid Benzyl-hydroxy-amide Small molecular drug D07ARK
5-thia-8,11,14,17-eicosatetraenoic Acid Small molecular drug D06JCT
6,7'-oxybis(2-phenyl-4h-chromen-4-one) Small molecular drug D0U1IJ
8alpha,19-dihydroxylabd-13 E-en-15-oic Acid Small molecular drug D0V8ZU
Alpha-linolenic Acid Small molecular drug D0C5SV
B-octylglucoside Small molecular drug D02UVH
Cimicoxib Small molecular drug DB05095
Dfu Small molecular drug D01MFK
Dihomo-gamma-linolenic Acid Small molecular drug DB00154
Firocoxib Small molecular drug D01SNR
Fluoro Loxoprofen Small molecular drug D0UH3D
Furan-3-yl(4-(Methylsulfonyl)Phenyl)Methanone Small molecular drug D0Q4LI
Ginseng Small molecular drug DB01404
Gw-637185x Small molecular drug D0EI8V
Heme Small molecular drug D0UU1I
Honokiol Small molecular drug D04DQJ
L-748780 Small molecular drug D0Q4FH
L-761000 Small molecular drug D03KSL
Licofelone Small molecular drug DB04725
Lm-4108 Small molecular drug D0QV6M
Magnesium Salicylate Small molecular drug DB01397
Methylhonokiol Small molecular drug D01OFH
Microxine Small molecular drug D08JML
Morniflumate Small molecular drug DB09285
N-(1h-indazol-5-yl)Acetamide Small molecular drug D0J7YE
N-(3-(Phenylthio)Pyridin-4-yl)Methanesulfonamide Small molecular drug D01WLL
N-(3-phenoxy-4-pyridinyl)Ethanesulfonamide Small molecular drug D0BO9W
N-(3-phenylamino-4-pyridinyl)Methanesulfonamide Small molecular drug D06DRL
Nabiximols Small molecular drug DB14011
Nectamazin C Small molecular drug D03ETD
Neolignan 9-nor-7,8-dehydro-isolicarin B Small molecular drug D0M6UZ
Niflumic Acid Small molecular drug DB04552
Nitroflurbiprofen Small molecular drug D04TNI
Nsc-27236 Small molecular drug D05JRZ
Ocophyllals A Small molecular drug D0UH3W
Ocophyllals B Small molecular drug D0Y1UG
Oxametacin Small molecular drug D0T9QW
Oxindole 94 Small molecular drug D0VC0I
Phenidone Small molecular drug D0P1LP
Prifelone Small molecular drug D00GBX
Primary Alcohol Metabolite Of Celecoxib Small molecular drug D0T4VL
Prostaglandin G2 Small molecular drug D02IPX
Resveratrol Small molecular drug DB02709
Resveratrol Potassium3-sulfate Small molecular drug D0CW3A
Resveratrol Potassium4,-sulfate Small molecular drug D04JZY
Sb 239063 Small molecular drug D08LYB
Sc-558 Small molecular drug D0C1GO
Seliciclib Small molecular drug DB06195
Tenosal Small molecular drug D0T3KZ
Thioctic Acid Small molecular drug D0P6PQ
Wogonin Small molecular drug D00MXS
4-(4-hydroxy-benzylideneamino)-benzenesulfonamide . D03VUQ
Bimetopyrole . D04IXJ
Bryostatin 1 . DB11752
C-myb . D03GHR
Clematomandshurica Saponin A . D07HKJ
Clematomandshurica Saponin B . D0Z7BK
Cr-4174 . D0KX7A
Cx-9051 . D0XC1F
Medical Cannabis . DB14009
Ns-398 . DB14060
Pac-10649 . D0YK4L
Propacetamol . DB09288
Semaxanib . DB06436
Silicon-modified Indomethacin . D0Y4ZI
Talniflumate . DB09295
Xgp-110 . D0N8TM
Patented
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Carbamate Derivative 2 Small molecular drug D0S8TB
Pmid29130358-compound-lonimacranthoidevi Small molecular drug D0JE1M
Withdrawn from market
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Indoprofen Small molecular drug D0Q5PL
Discontinued
Click To Hide/Show 32 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Apricoxib Small molecular drug D0S7IZ
Atliprofen Methyl Ester Small molecular drug D03AKL
Droxicam Small molecular drug DB09215
Dup 697 Small molecular drug D08GRY
Flosulide Small molecular drug D05REH
Gsk-644784 Small molecular drug D05HVY
Gw-406381 Small molecular drug D00RSK
L-745337 Small molecular drug D05EYG
Nimesulide Small molecular drug D0C0JT
Ns398 Small molecular drug D09BKE
Prinomide Tromethamine Small molecular drug D0V7HI
R-ketoprofen Small molecular drug D0ZL4F
Rpr 200765a Small molecular drug D01QRG
S-2474 Small molecular drug D04DUJ
Sb 203580 Small molecular drug D0F8DL
Sc-236 Small molecular drug D03NZV
Sc-57666 Small molecular drug D02OHR
Sc-58125 Small molecular drug D07TZM
Sc-58451 Small molecular drug D0O9JX
Tebufelone Small molecular drug D0P3KA
Tilmacoxib Small molecular drug D0Z5LZ
Crx-401 . D0BZ1Q
E-6087 . D07RUC
Fr-123826 . D0R5TT
Gr-253035 . D0C2HF
L-768277 . D0B0TO
Nmi-150 . D0Z5OJ
On-09300 . D02KQE
Pmi-001 . D0I9LH
Rq-00317076 . D02HLL
Rwj-63556 . D08JKK
S-33516 . D0DR3I

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
5 A Global Map of Lipid-Binding Proteins and Their Ligandability in Cells. Cell. 2015 Jun 18;161(7):1668-80. doi: 10.1016/j.cell.2015.05.045.