Details of the Target
General Information of Target
Target ID | LDTP03500 | |||||
---|---|---|---|---|---|---|
Target Name | 2'-5'-oligoadenylate synthase 2 (OAS2) | |||||
Gene Name | OAS2 | |||||
Gene ID | 4939 | |||||
Synonyms |
2'-5'-oligoadenylate synthase 2; (2-5')oligo(A) synthase 2; 2-5A synthase 2; EC 2.7.7.84; p69 OAS / p71 OAS; p69OAS / p71OAS |
|||||
3D Structure | ||||||
Sequence |
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIG
GSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEI QKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVC FTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKD NFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNILLHQLQSARPVILDPVDPTNN VSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDKFIKEFLQPNK CFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKS YTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSF DVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLK DLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVT QYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEA KEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVNEMFSSRSHRILNNNSKRNF |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
2-5A synthase family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Activated by detection of double stranded RNA (dsRNA): polymerizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNASEL) leading to its dimerization and subsequent activation. Activation of RNASEL leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNASEL-dependent pathway or an alternative antiviral pathway independent of RNASEL. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. May act as a negative regulator of lactation, stopping lactation in virally infected mammary gland lobules, thereby preventing transmission of viruses to neonates. Non-infected lobules would not be affected, allowing efficient pup feeding during infection.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
K560(0.64) | LDD0275 | [1] | |
HPAP Probe Info |
![]() |
4.96 | LDD0064 | [2] | |
DBIA Probe Info |
![]() |
C108(37.16) | LDD0209 | [3] | |
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C361(0.00); C307(0.00); C523(0.00); C180(0.00) | LDD0038 | [4] | |
IA-alkyne Probe Info |
![]() |
C668(0.00); C361(0.00); C210(0.00); C307(0.00) | LDD0036 | [4] | |
Lodoacetamide azide Probe Info |
![]() |
C361(0.00); C668(0.00); C307(0.00); C180(0.00) | LDD0037 | [4] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [5] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C668(0.94); C180(0.82); C381(1.61) | LDD2187 | [6] |
LDCM0572 | Fragment10 | Ramos | C668(1.25); C180(0.55) | LDD2189 | [6] |
LDCM0573 | Fragment11 | Ramos | C668(0.39); C180(0.32); C381(2.32) | LDD2190 | [6] |
LDCM0574 | Fragment12 | Ramos | C668(1.07); C180(1.09) | LDD2191 | [6] |
LDCM0575 | Fragment13 | Ramos | C668(0.97); C180(0.75); C381(0.68) | LDD2192 | [6] |
LDCM0576 | Fragment14 | Ramos | C668(1.25); C180(0.60); C381(1.59) | LDD2193 | [6] |
LDCM0579 | Fragment20 | Ramos | C668(1.22); C180(1.83) | LDD2194 | [6] |
LDCM0580 | Fragment21 | Ramos | C668(0.99); C180(1.05) | LDD2195 | [6] |
LDCM0582 | Fragment23 | Ramos | C668(0.95); C180(1.32); C381(0.79) | LDD2196 | [6] |
LDCM0578 | Fragment27 | Ramos | C668(0.84); C180(0.92); C381(0.57) | LDD2197 | [6] |
LDCM0586 | Fragment28 | Ramos | C668(0.93); C180(2.14); C381(0.59) | LDD2198 | [6] |
LDCM0588 | Fragment30 | Ramos | C668(0.96); C180(1.39); C381(1.67) | LDD2199 | [6] |
LDCM0589 | Fragment31 | Ramos | C668(0.92); C180(0.92); C381(1.24) | LDD2200 | [6] |
LDCM0590 | Fragment32 | Ramos | C668(1.00); C180(0.64) | LDD2201 | [6] |
LDCM0468 | Fragment33 | Ramos | C668(0.86); C180(0.78) | LDD2202 | [6] |
LDCM0596 | Fragment38 | Ramos | C668(0.93); C180(0.85) | LDD2203 | [6] |
LDCM0566 | Fragment4 | Ramos | C668(1.06); C180(1.13); C381(1.17); C652(1.72) | LDD2184 | [6] |
LDCM0610 | Fragment52 | Ramos | C668(0.81); C180(0.87) | LDD2204 | [6] |
LDCM0614 | Fragment56 | Ramos | C668(0.99); C180(1.02) | LDD2205 | [6] |
LDCM0569 | Fragment7 | Ramos | C668(1.49); C180(0.97); C381(1.46); C652(0.97) | LDD2186 | [6] |
LDCM0571 | Fragment9 | Ramos | C668(1.64); C180(1.11) | LDD2188 | [6] |
LDCM0022 | KB02 | T cell | C361(8.55) | LDD1703 | [7] |
LDCM0023 | KB03 | Jurkat | C108(37.16) | LDD0209 | [3] |
LDCM0024 | KB05 | COLO792 | C668(1.89); C180(1.27); C652(2.34) | LDD3310 | [8] |
LDCM0014 | Panhematin | hPBMC | 4.96 | LDD0064 | [2] |
The Interaction Atlas With This Target
References