Details of the Target
General Information of Target
| Target ID | LDTP03377 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ciliary neurotrophic factor receptor subunit alpha (CNTFR) | |||||
| Gene Name | CNTFR | |||||
| Gene ID | 1271 | |||||
| Synonyms |
Ciliary neurotrophic factor receptor subunit alpha; CNTF receptor subunit alpha; CNTFR-alpha |
|||||
| 3D Structure | ||||||
| Sequence |
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL AAAAATASSLLI |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Type I cytokine receptor family, Type 3 subfamily
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Binds to CNTF. The alpha subunit provides the receptor specificity. Receptor for heterodimeric neurotropic cytokine composed of CLCF1/CLC and CRLF1/CLF-1. Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL6ST/GP130 and IL27RA/WSX1.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
![]() |
2.14 | LDD0054 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target

