Details of the Target

General Information of Target

Target ID LDTP03336
Target Name Protein S100-P (S100P)
Gene Name S100P
Gene ID 6286
Synonyms
S100E; Protein S100-P; Migration-inducing gene 9 protein; MIG9; Protein S100-E; S100 calcium-binding protein P
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Target Bioclass
Other
Family
S-100 family
Subcellular location
Nucleus
Function
May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).
Uniprot ID
P25815
Ensemble ID
ENST00000296370.4
HGNC ID
HGNC:10504

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P3
 Probe Info  		10.00  LDD0450  [1]
P8
 Probe Info  		10.00  LDD0451  [1]
YN-1
 Probe Info  		100.00  LDD0444  [2]
AZ-9
 Probe Info  		E22(5.45)  LDD2209  [3]
Probe 1
 Probe Info  		Y18(7.14)  LDD3495  [4]
ATP probe
 Probe Info  		N.A.  LDD0035  [5]
IA-alkyne
 Probe Info  		N.A.  LDD0149  [6]
NAIA_5
 Probe Info  		N.A.  LDD2223  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Myosin-9 (MYH9) Myosin family P35579
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Cellular tumor antigen p53 (TP53) P53 family P04637
Protein S100-A1 (S100A1) S-100 family P23297
Protein S100-B (S100B) S-100 family P04271
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Telomeric repeat-binding factor 2-interacting protein 1 (TERF2IP) RAP1 family Q9NYB0
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Advanced glycosylation end product-specific receptor (AGER) . Q15109
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-11 (IL11) IL-6 superfamily P20809
Other
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Activity-regulated cytoskeleton-associated protein (ARC) ARC/ARG3.1 family Q7LC44
F-actin-capping protein subunit alpha-1 (CAPZA1) F-actin-capping protein alpha subunit family P52907
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Protein S100-Z (S100Z) S-100 family Q8WXG8
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Transforming growth factor-beta-induced protein ig-h3 (TGFBI) . Q15582
Ubiquitin-like protein 4A (UBL4A) . P11441

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cromoglicic Acid Small molecular drug DB01003

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
3 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
4 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
5 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
6 Sequence-Based Prediction of Cysteine Reactivity Using Machine Learning. Biochemistry. 2018 Jan 30;57(4):451-460. doi: 10.1021/acs.biochem.7b00897. Epub 2017 Oct 26.
7 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264