General Information of Target

Target ID LDTP03053
Target Name Nuclear receptor subfamily 1 group D member 1 (NR1D1)
Gene Name NR1D1
Gene ID 9572
Synonyms
EAR1; HREV; THRAL; Nuclear receptor subfamily 1 group D member 1; Rev-erbA-alpha; V-erbA-related protein 1; EAR-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ
Target Type
Preclinical
Target Bioclass
Transcription factor
Family
Nuclear hormone receptor family, NR1 subfamily
Subcellular location
Nucleus
Function
Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of the circadian clock by directly repressing the expression of core clock components BMAL1, CLOCK and CRY1. Also regulates genes involved in metabolic functions, including lipid and bile acid metabolism, adipogenesis, gluconeogenesis and the macrophage inflammatory response. Acts as a receptor for heme which stimulates its interaction with the NCOR1/HDAC3 corepressor complex, enhancing transcriptional repression. Recognizes two classes of DNA response elements within the promoter of its target genes and can bind to DNA as either monomers or homodimers, depending on the nature of the response element. Binds as a monomer to a response element composed of the consensus half-site motif 5'-[A/G]GGTCA-3' preceded by an A/T-rich 5' sequence (RevRE), or as a homodimer to a direct repeat of the core motif spaced by two nucleotides (RevDR-2). Acts as a potent competitive repressor of ROR alpha (RORA) function and regulates the levels of its ligand heme by repressing the expression of PPARGC1A, a potent inducer of heme synthesis. Regulates lipid metabolism by repressing the expression of APOC3 and by influencing the activity of sterol response element binding proteins (SREBPs); represses INSIG2 which interferes with the proteolytic activation of SREBPs which in turn govern the rhythmic expression of enzymes with key functions in sterol and fatty acid synthesis. Regulates gluconeogenesis via repression of G6PC1 and PEPCK and adipocyte differentiation via repression of PPARG. Regulates glucagon release in pancreatic alpha-cells via the AMPK-NAMPT-SIRT1 pathway and the proliferation, glucose-induced insulin secretion and expression of key lipogenic genes in pancreatic-beta cells. Positively regulates bile acid synthesis by increasing hepatic expression of CYP7A1 via repression of NR0B2 and NFIL3 which are negative regulators of CYP7A1. Modulates skeletal muscle oxidative capacity by regulating mitochondrial biogenesis and autophagy; controls mitochondrial biogenesis and respiration by interfering with the STK11-PRKAA1/2-SIRT1-PPARGC1A signaling pathway. Represses the expression of SERPINE1/PAI1, an important modulator of cardiovascular disease and the expression of inflammatory cytokines and chemokines in macrophages. Represses gene expression at a distance in macrophages by inhibiting the transcription of enhancer-derived RNAs (eRNAs). Plays a role in the circadian regulation of body temperature and negatively regulates thermogenic transcriptional programs in brown adipose tissue (BAT); imposes a circadian oscillation in BAT activity, increasing body temperature when awake and depressing thermogenesis during sleep. In concert with NR2E3, regulates transcriptional networks critical for photoreceptor development and function. In addition to its activity as a repressor, can also act as a transcriptional activator. In the ovarian granulosa cells acts as a transcriptional activator of STAR which plays a role in steroid biosynthesis. In collaboration with SP1, activates GJA1 transcription in a heme-independent manner. Represses the transcription of CYP2B10, CYP4A10 and CYP4A14. Represses the transcription of CES2. Represses and regulates the circadian expression of TSHB in a NCOR1-dependent manner. Negatively regulates the protein stability of NR3C1 and influences the time-dependent subcellular distribution of NR3C1, thereby affecting its transcriptional regulatory activity. Plays a critical role in the circadian control of neutrophilic inflammation in the lung; under resting, non-stress conditions, acts as a rhythmic repressor to limit inflammatory activity whereas in the presence of inflammatory triggers undergoes ubiquitin-mediated degradation thereby relieving inhibition of the inflammatory response. Plays a key role in the circadian regulation of microglial activation and neuroinflammation; suppresses microglial activation through the NF-kappaB pathway in the central nervous system. Plays a role in the regulation of the diurnal rhythms of lipid and protein metabolism in the skeletal muscle via transcriptional repression of genes controlling lipid and amino acid metabolism in the muscle.
TTD ID
T00254
Uniprot ID
P20393
DrugMap ID
TTAD1O8
Ensemble ID
ENST00000246672.4
HGNC ID
HGNC:7962
ChEMBL ID
CHEMBL1961783

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C132(1.07)  LDD0547  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0226  AC11 HEK-293T C193(1.11)  LDD1509  [2]
 LDCM0230  AC113 HCT 116 C132(1.07)  LDD0547  [1]
 LDCM0231  AC114 HCT 116 C132(1.15)  LDD0548  [1]
 LDCM0232  AC115 HCT 116 C132(1.31)  LDD0549  [1]
 LDCM0233  AC116 HCT 116 C132(1.38)  LDD0550  [1]
 LDCM0234  AC117 HCT 116 C132(1.06)  LDD0551  [1]
 LDCM0235  AC118 HCT 116 C132(0.94)  LDD0552  [1]
 LDCM0236  AC119 HCT 116 C132(1.15)  LDD0553  [1]
 LDCM0238  AC120 HCT 116 C132(1.33)  LDD0555  [1]
 LDCM0239  AC121 HCT 116 C132(1.11)  LDD0556  [1]
 LDCM0240  AC122 HCT 116 C132(1.06)  LDD0557  [1]
 LDCM0241  AC123 HCT 116 C132(0.94)  LDD0558  [1]
 LDCM0242  AC124 HCT 116 C132(0.92)  LDD0559  [1]
 LDCM0243  AC125 HCT 116 C132(1.11)  LDD0560  [1]
 LDCM0244  AC126 HCT 116 C132(1.27)  LDD0561  [1]
 LDCM0245  AC127 HCT 116 C132(1.05)  LDD0562  [1]
 LDCM0246  AC128 HCT 116 C132(0.91)  LDD0563  [1]
 LDCM0247  AC129 HCT 116 C132(0.80)  LDD0564  [1]
 LDCM0249  AC130 HCT 116 C132(0.83)  LDD0566  [1]
 LDCM0250  AC131 HCT 116 C132(0.99)  LDD0567  [1]
 LDCM0251  AC132 HCT 116 C132(0.97)  LDD0568  [1]
 LDCM0252  AC133 HCT 116 C132(1.23)  LDD0569  [1]
 LDCM0253  AC134 HCT 116 C132(1.21)  LDD0570  [1]
 LDCM0254  AC135 HCT 116 C132(0.92)  LDD0571  [1]
 LDCM0255  AC136 HCT 116 C132(1.01)  LDD0572  [1]
 LDCM0256  AC137 HCT 116 C132(0.88)  LDD0573  [1]
 LDCM0257  AC138 HCT 116 C132(1.20)  LDD0574  [1]
 LDCM0258  AC139 HCT 116 C132(1.04)  LDD0575  [1]
 LDCM0260  AC140 HCT 116 C132(1.18)  LDD0577  [1]
 LDCM0261  AC141 HCT 116 C132(1.05)  LDD0578  [1]
 LDCM0262  AC142 HCT 116 C132(0.95)  LDD0579  [1]
 LDCM0263  AC143 HCT 116 C132(1.02)  LDD0580  [1]
 LDCM0264  AC144 HCT 116 C132(0.98)  LDD0581  [1]
 LDCM0265  AC145 HCT 116 C132(1.06)  LDD0582  [1]
 LDCM0266  AC146 HCT 116 C132(1.20)  LDD0583  [1]
 LDCM0267  AC147 HCT 116 C132(0.83)  LDD0584  [1]
 LDCM0268  AC148 HCT 116 C132(1.42)  LDD0585  [1]
 LDCM0269  AC149 HCT 116 C132(1.19)  LDD0586  [1]
 LDCM0271  AC150 HCT 116 C132(0.92)  LDD0588  [1]
 LDCM0272  AC151 HCT 116 C132(0.93)  LDD0589  [1]
 LDCM0273  AC152 HCT 116 C132(0.96)  LDD0590  [1]
 LDCM0274  AC153 HCT 116 C132(1.03)  LDD0591  [1]
 LDCM0621  AC154 HCT 116 C132(0.83)  LDD2158  [1]
 LDCM0622  AC155 HCT 116 C132(0.92)  LDD2159  [1]
 LDCM0623  AC156 HCT 116 C132(0.99)  LDD2160  [1]
 LDCM0624  AC157 HCT 116 C132(0.98)  LDD2161  [1]
 LDCM0276  AC17 HCT 116 C132(0.92)  LDD0593  [1]
 LDCM0277  AC18 HCT 116 C132(0.78)  LDD0594  [1]
 LDCM0278  AC19 HCT 116 C132(0.83)  LDD0595  [1]
 LDCM0280  AC20 HCT 116 C132(1.01)  LDD0597  [1]
 LDCM0281  AC21 HCT 116 C132(0.83)  LDD0598  [1]
 LDCM0282  AC22 HCT 116 C132(0.95)  LDD0599  [1]
 LDCM0283  AC23 HCT 116 C132(0.87)  LDD0600  [1]
 LDCM0284  AC24 HCT 116 C132(0.97)  LDD0601  [1]
 LDCM0287  AC27 HEK-293T C193(0.99)  LDD1526  [2]
 LDCM0290  AC3 HEK-293T C193(0.99)  LDD1529  [2]
 LDCM0296  AC35 HEK-293T C193(1.38)  LDD1535  [2]
 LDCM0305  AC43 HEK-293T C193(0.79)  LDD1544  [2]
 LDCM0314  AC51 HEK-293T C193(1.06)  LDD1553  [2]
 LDCM0322  AC59 HEK-293T C193(0.95)  LDD1561  [2]
 LDCM0332  AC68 HCT 116 C132(0.82)  LDD0649  [1]
 LDCM0333  AC69 HCT 116 C132(0.74)  LDD0650  [1]
 LDCM0335  AC70 HCT 116 C132(0.76)  LDD0652  [1]
 LDCM0336  AC71 HCT 116 C132(0.80)  LDD0653  [1]
 LDCM0337  AC72 HCT 116 C132(0.87)  LDD0654  [1]
 LDCM0338  AC73 HCT 116 C132(0.98)  LDD0655  [1]
 LDCM0339  AC74 HCT 116 C132(0.96)  LDD0656  [1]
 LDCM0340  AC75 HCT 116 C132(0.83)  LDD0657  [1]
 LDCM0341  AC76 HCT 116 C132(0.93)  LDD0658  [1]
 LDCM0342  AC77 HCT 116 C132(0.88)  LDD0659  [1]
 LDCM0343  AC78 HCT 116 C132(0.91)  LDD0660  [1]
 LDCM0344  AC79 HCT 116 C132(0.85)  LDD0661  [1]
 LDCM0346  AC80 HCT 116 C132(0.86)  LDD0663  [1]
 LDCM0347  AC81 HCT 116 C132(0.67)  LDD0664  [1]
 LDCM0348  AC82 HCT 116 C132(0.66)  LDD0665  [1]
 LDCM0367  CL1 HCT 116 C132(1.04)  LDD0684  [1]
 LDCM0368  CL10 HCT 116 C132(1.20)  LDD0685  [1]
 LDCM0374  CL105 HCT 116 C132(0.87)  LDD0691  [1]
 LDCM0375  CL106 HCT 116 C132(0.71)  LDD0692  [1]
 LDCM0376  CL107 HCT 116 C132(0.82)  LDD0693  [1]
 LDCM0377  CL108 HCT 116 C132(0.83)  LDD0694  [1]
 LDCM0378  CL109 HCT 116 C132(1.01)  LDD0695  [1]
 LDCM0379  CL11 HCT 116 C132(1.12)  LDD0696  [1]
 LDCM0380  CL110 HCT 116 C132(0.95)  LDD0697  [1]
 LDCM0381  CL111 HCT 116 C132(1.07)  LDD0698  [1]
 LDCM0390  CL12 HCT 116 C132(1.21)  LDD0707  [1]
 LDCM0400  CL13 HCT 116 C132(1.18)  LDD0717  [1]
 LDCM0401  CL14 HCT 116 C132(1.26)  LDD0718  [1]
 LDCM0402  CL15 HCT 116 C132(0.97)  LDD0719  [1]
 LDCM0406  CL19 HEK-293T C193(1.04)  LDD1610  [2]
 LDCM0407  CL2 HCT 116 C132(0.97)  LDD0724  [1]
 LDCM0418  CL3 HCT 116 C132(1.02)  LDD0735  [1]
 LDCM0420  CL31 HEK-293T C193(1.29)  LDD1624  [2]
 LDCM0429  CL4 HCT 116 C132(1.19)  LDD0746  [1]
 LDCM0433  CL43 HEK-293T C193(0.91)  LDD1637  [2]
 LDCM0440  CL5 HCT 116 C132(0.82)  LDD0757  [1]
 LDCM0446  CL55 HEK-293T C193(1.42)  LDD1649  [2]
 LDCM0451  CL6 HCT 116 C132(1.02)  LDD0768  [1]
 LDCM0459  CL67 HEK-293T C193(0.99)  LDD1662  [2]
 LDCM0462  CL7 HCT 116 C132(0.95)  LDD0779  [1]
 LDCM0472  CL79 HEK-293T C193(1.08)  LDD1675  [2]
 LDCM0473  CL8 HCT 116 C132(1.11)  LDD0790  [1]
 LDCM0484  CL9 HCT 116 C132(1.02)  LDD0801  [1]
 LDCM0486  CL91 HEK-293T C193(1.03)  LDD1689  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
Tryptophan 2,3-dioxygenase (TDO2) Tryptophan 2,3-dioxygenase family P48775
E3 ubiquitin-protein ligase HUWE1 (HUWE1) UPL family Q7Z6Z7
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear receptor corepressor 1 (NCOR1) N-CoR nuclear receptor corepressors family O75376
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein A-IV (APOA4) Apolipoprotein A1/A4/E family P06727

The Drug(s) Related To This Target

Preclinical
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Gsk4112 Small molecular drug D07IZG
Sr8278 Small molecular drug D0K1VV
Sr9009 Small molecular drug D40DVS
Sr9011 Small molecular drug DW18LK
Investigative
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Sr-9009 . DB14013
Sr-9011 . DB14014

References

1 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402