General Information of Target

Target ID LDTP02972
Target Name ATP synthase-coupling factor 6, mitochondrial (ATP5PF)
Gene Name ATP5PF
Gene ID 522
Synonyms
ATP5A; ATP5J; ATPM; ATP synthase-coupling factor 6, mitochondrial; ATPase subunit F6; ATP synthase peripheral stalk subunit F6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP
VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Target Bioclass
Transporter and channel
Family
Eukaryotic ATPase subunit F6 family
Subcellular location
Mitochondrion
Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes.
Uniprot ID
P18859
Ensemble ID
ENST00000284971.8
HGNC ID
HGNC:847

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NCIH661 SNV: p.R22L .
SKMEL24 SNV: p.A31T .
SNU245 SNV: p.Q68Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
ONAyne
 Probe Info 
K46(1.00)  LDD0274  [1]
STPyne
 Probe Info 
K105(1.00); K34(6.67); K46(5.23); K79(7.20)  LDD0277  [1]
OPA-S-S-alkyne
 Probe Info 
K105(3.04); K46(4.70)  LDD3494  [2]
Probe 1
 Probe Info 
Y67(14.24)  LDD3495  [3]
ATP probe
 Probe Info 
N.A.  LDD0199  [4]
1c-yne
 Probe Info 
K99(0.00); K79(0.00)  LDD0228  [5]
1d-yne
 Probe Info 
N.A.  LDD0357  [5]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Staurosporine capture compound
 Probe Info 
N.A.  LDD0083  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0019  Staurosporine Hep-G2 N.A.  LDD0083  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Phosphatidylserine lipase ABHD16A (ABHD16A) ABHD16 family O95870
Pyridoxal phosphate phosphatase PHOSPHO2 (PHOSPHO2) PHOSPHO family Q8TCD6
Inositol polyphosphate 5-phosphatase K (INPP5K) Inositol 1,4,5-trisphosphate 5-phosphatase type II family Q9BT40
Tyrosine-protein phosphatase non-receptor type 9 (PTPN9) Protein-tyrosine phosphatase family P43378
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase subunit alpha, mitochondrial (ATP5F1A) ATPase alpha/beta chains family P25705
Bcl-2-like protein 2 (BCL2L2) Bcl-2 family Q92843
Potassium channel subfamily K member 5 (KCNK5) Two pore domain potassium channel (TC 1.A.1.8) family O95279
Proteolipid protein 2 (PLP2) . Q04941
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sialic acid-binding Ig-like lectin 12 (SIGLEC12) SIGLEC (sialic acid binding Ig-like lectin) family Q96PQ1
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
MAL-like protein (MALL) MAL family Q13021
Vesicle transport protein SFT2B (SFT2D2) SFT2 family O95562
Mitochondrial dynamics protein MIEF1 (MIEF1) SMCR7 family Q9NQG6
Motile sperm domain-containing protein 3 (MOSPD3) . O75425

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
5 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
6 Comprehensive identification of staurosporine-binding kinases in the hepatocyte cell line HepG2 using Capture Compound Mass Spectrometry (CCMS). J Proteome Res. 2010 Feb 5;9(2):806-17. doi: 10.1021/pr9007333.