Details of the Target
General Information of Target
| Target ID | LDTP02886 | |||||
|---|---|---|---|---|---|---|
| Target Name | High mobility group protein HMG-I/HMG-Y (HMGA1) |
|
||||
| Gene Name | HMGA1 | |||||
| Gene ID | 3159 | |||||
| Synonyms |
HMGIY; High mobility group protein HMG-I/HMG-Y; HMG-I(Y); High mobility group AT-hook protein 1; High mobility group protein A1; High mobility group protein R |
|||||
| 3D Structure | ||||||
| Sequence |
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
HMGA family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
P2 Probe Info |
 |
10.00 | LDD0449 | [1] | |
|
P8 Probe Info |
 |
10.00 | LDD0451 | [1] | |
|
ONAyne Probe Info |
 |
K15(1.50); K46(3.14); K74(0.97) | LDD0274 | [2] | |
|
STPyne Probe Info |
 |
K15(8.56); K18(5.88); K31(4.25); K46(8.21) | LDD0277 | [2] | |
|
NHS Probe Info |
 |
K46(0.00); K55(0.00); K7(0.00) | LDD0010 | [3] | |
|
SF Probe Info |
 |
K15(0.00); K46(0.00); K7(0.00) | LDD0028 | [4] | |
|
1c-yne Probe Info |
 |
N.A. | LDD0228 | [5] | |
|
1d-yne Probe Info |
 |
N.A. | LDD0357 | [5] | |
The Interaction Atlas With This Target
References