General Information of Target

Target ID LDTP02413
Target Name Polyubiquitin-C (UBC)
Gene Name UBC
Gene ID 7316
Synonyms
Polyubiquitin-C [Cleaved into: Ubiquitin]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGV
Target Type
Patented-recorded
Target Bioclass
Other
Family
Ubiquitin family
Subcellular location
Cytoplasm
Function
[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stress response and cell cycle; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.
TTD ID
T90167
Uniprot ID
P0CG48
DrugMap ID
TTBP3XA
Ensemble ID
ENST00000339647.6
HGNC ID
HGNC:12468
ChEMBL ID
CHEMBL4523179

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
HHS-465
 Probe Info 
Y59(4.27)  LDD2237  [1]
Acrolein
 Probe Info 
N.A.  LDD0221  [2]
1d-yne
 Probe Info 
N.A.  LDD0358  [3]
AZ-9
 Probe Info 
E24(0.00); E18(0.00)  LDD0395  [4]
Crotonaldehyde
 Probe Info 
N.A.  LDD0219  [2]
Methacrolein
 Probe Info 
N.A.  LDD0218  [2]
MPP-AC
 Probe Info 
N.A.  LDD0428  [5]
TER-AC
 Probe Info 
N.A.  LDD0426  [5]
TPP-AC
 Probe Info 
N.A.  LDD0427  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [2]
 LDCM0107  IAA HeLa N.A.  LDD0221  [2]
 LDCM0109  NEM HeLa N.A.  LDD0223  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 26 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) ABCG family Q9UNQ0
Poly [ADP-ribose] polymerase 1 (PARP1) ARTD/PARP family P09874
E3 ubiquitin-protein ligase DTX1 (DTX1) Deltex family Q86Y01
Desumoylating isopeptidase 1 (DESI1) DeSI family Q6ICB0
DNA polymerase eta (POLH) DNA polymerase type-Y family Q9Y253
DNA polymerase iota (POLI) DNA polymerase type-Y family Q9UNA4
E3 ubiquitin-protein ligase XIAP (XIAP) IAP family P98170
E3 ubiquitin-protein ligase Mdm2 (MDM2) MDM2/MDM4 family Q00987
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (MALT1) Peptidase C14B family Q9UDY8
Sentrin-specific protease 3 (SENP3) Peptidase C48 family Q9H4L4
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
26S proteasome non-ATPase regulatory subunit 4 (PSMD4) Proteasome subunit S5A family P55036
Beta-adrenergic receptor kinase 1 (GRK2) AGC Ser/Thr protein kinase family P25098
Protein kinase C alpha type (PRKCA) AGC Ser/Thr protein kinase family P17252
Cyclin-dependent kinase 1 (CDK1) CMGC Ser/Thr protein kinase family P06493
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (BUB1B) Ser/Thr protein kinase family O60566
Mitogen-activated protein kinase kinase kinase 4 (MAP3K4) STE Ser/Thr protein kinase family Q9Y6R4
Mitogen-activated protein kinase kinase kinase 7 (MAP3K7) STE Ser/Thr protein kinase family O43318
Tyrosine-protein kinase Lck (LCK) Tyr protein kinase family P06239
Retinol dehydrogenase 12 (RDH12) Short-chain dehydrogenases/reductases (SDR) family Q96NR8
TNF receptor-associated factor 6 (TRAF6) TNF receptor-associated factor family Q9Y4K3
Ubiquitin-conjugating enzyme E2 G2 (UBE2G2) Ubiquitin-conjugating enzyme family P60604
E3 ubiquitin-protein ligase MARCHF5 (MARCHF5) . Q9NX47
Polycomb complex protein BMI-1 (BMI1) . P35226
Polycomb group RING finger protein 2 (PCGF2) . P35227
Ubiquitin thioesterase OTU1 (YOD1) . Q5VVQ6
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Cellular tumor antigen p53 (TP53) P53 family P04637
Phospholipid scramblase 4 (PLSCR4) Phospholipid scramblase family Q9NRQ2
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 5 (KLF5) Krueppel C2H2-type zinc-finger protein family Q13887
NF-kappa-B inhibitor alpha (NFKBIA) NF-kappa-B inhibitor family P25963
Myc proto-oncogene protein (MYC) . P01106
Nuclear factor of activated T-cells, cytoplasmic 4 (NFATC4) . Q14934
Transcription factor p65 (RELA) . Q04206
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Granulocyte colony-stimulating factor receptor (CSF3R) Type I cytokine receptor family Q99062
Other
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proteasomal ubiquitin receptor ADRM1 (ADRM1) ADRM1 family Q16186
Cell death-inducing p53-target protein 1 (CDIP1) CDIP1/LITAF family Q9H305
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
Density-regulated protein (DENR) DENR family O43583
Maturin (MTURN) MTURN family Q8N3F0
UV excision repair protein RAD23 homolog B (RAD23B) RAD23 family P54727
ELAV-like protein 1 (ELAVL1) RRM elav family Q15717
Sorting nexin-9 (SNX9) Sorting nexin family Q9Y5X1
Signal transducing adapter molecule 1 (STAM) STAM family Q92783
AN1-type zinc finger protein 5 (ZFAND5) . O76080
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1) . Q9ULH1
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (ASAP2) . O43150
Cytoplasmic protein NCK2 (NCK2) . O43639
DAZ-associated protein 2 (DAZAP2) . Q15038
Next to BRCA1 gene 1 protein (NBR1) . Q14596
NF-kappa-B essential modulator (IKBKG) . Q9Y6K9
Pleckstrin homology domain-containing family B member 2 (PLEKHB2) . Q96CS7
RING1 and YY1-binding protein (RYBP) . Q8N488
Sequestosome-1 (SQSTM1) . Q13501
SH3 domain-containing kinase-binding protein 1 (SH3KBP1) . Q96B97
Tax1-binding protein 1 (TAX1BP1) . Q86VP1
Ubiquilin-2 (UBQLN2) . Q9UHD9
Ubiquitin-associated domain-containing protein 1 (UBAC1) . Q9BSL1

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
N-formylmethionine Small molecular drug DB04464
Patented
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid25553724-compound-us20130237529 35 . D0JA8J
Pmid25553724-compound-us20130237529 36 . D0B2AE

References

1 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
4 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
5 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.