Details of the Target
General Information of Target
| Target ID | LDTP02413 | |||||
|---|---|---|---|---|---|---|
| Target Name | Polyubiquitin-C (UBC) | |||||
| Gene Name | UBC | |||||
| Gene ID | 7316 | |||||
| Synonyms |
Polyubiquitin-C [Cleaved into: Ubiquitin] |
|||||
| 3D Structure | ||||||
| Sequence |
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED GRTLSDYNIQKESTLHLVLRLRGGV |
|||||
| Target Type |
Patented-recorded
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Ubiquitin family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stress response and cell cycle; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-465 Probe Info |
![]() |
Y59(4.27) | LDD2237 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [2] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0358 | [3] | |
|
AZ-9 Probe Info |
![]() |
E24(0.00); E18(0.00) | LDD0395 | [4] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [2] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] | |
|
MPP-AC Probe Info |
![]() |
N.A. | LDD0428 | [5] | |
|
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [5] | |
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [5] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Cellular tumor antigen p53 (TP53) | P53 family | P04637 | |||
| Phospholipid scramblase 4 (PLSCR4) | Phospholipid scramblase family | Q9NRQ2 | |||
Transcription factor
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Granulocyte colony-stimulating factor receptor (CSF3R) | Type I cytokine receptor family | Q99062 | |||
Other
References









