General Information of Target

Target ID LDTP02412
Target Name Polyubiquitin-B (UBB)
Gene Name UBB
Gene ID 7314
Synonyms
Polyubiquitin-B [Cleaved into: Ubiquitin]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
Target Bioclass
Other
Family
Ubiquitin family
Subcellular location
Cytoplasm
Function
[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stress response and cell cycle; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.
Uniprot ID
P0CG47
Ensemble ID
ENST00000302182.8
HGNC ID
HGNC:12463
ChEMBL ID
CHEMBL4523178

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
1oxF11yne
 Probe Info 
N.A.  LDD0193  [1]
OPA-S-S-alkyne
 Probe Info 
K33(1.81); K48(4.35)  LDD3494  [2]
Probe 1
 Probe Info 
Y59(29.86)  LDD3495  [3]
HHS-465
 Probe Info 
Y59(4.27)  LDD2237  [4]
m-APA
 Probe Info 
N.A.  LDD2231  [5]
AZ-9
 Probe Info 
E24(0.00); E18(0.00)  LDD0395  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Superoxide dismutase [Cu-Zn] (SOD1) Cu-Zn superoxide dismutase family P00441
Desumoylating isopeptidase 1 (DESI1) DeSI family Q6ICB0
DNA replication licensing factor MCM7 (MCM7) MCM family P33993
Ubiquitin thioesterase OTUB1 (OTUB1) Peptidase C65 family Q96FW1
STAM-binding protein (STAMBP) Peptidase M67C family O95630
Dual specificity protein phosphatase 1 (DUSP1) Protein-tyrosine phosphatase family P28562
E3 ubiquitin-protein ligase RNF43 (RNF43) ZNRF3 family Q68DV7
E3 ubiquitin-protein ligase NEDD4 (NEDD4) . P46934
E3 ubiquitin-protein ligase SMURF2 (SMURF2) . Q9HAU4
Transporter and channel
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
ADP-ribosylation factor-binding protein GGA1 (GGA1) GGA protein family Q9UJY5
ADP-ribosylation factor-binding protein GGA3 (GGA3) GGA protein family Q9NZ52
Phospholipid scramblase 4 (PLSCR4) Phospholipid scramblase family Q9NRQ2
Rab5 GDP/GTP exchange factor (RABGEF1) . Q9UJ41
Syntenin-1 (SDCBP) . O00560
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cell death-inducing p53-target protein 1 (CDIP1) CDIP1/LITAF family Q9H305
Maturin (MTURN) MTURN family Q8N3F0
UV excision repair protein RAD23 homolog B (RAD23B) RAD23 family P54727
Signal transducing adapter molecule 2 (STAM2) STAM family O75886
Coiled-coil domain-containing protein 50 (CCDC50) . Q8IVM0
DAZ-associated protein 2 (DAZAP2) . Q15038
Pleckstrin homology domain-containing family B member 2 (PLEKHB2) . Q96CS7
RING finger protein 11 (RNF11) . Q9Y3C5
RING1 and YY1-binding protein (RYBP) . Q8N488
Tax1-binding protein 1 (TAX1BP1) . Q86VP1
Ubiquilin-2 (UBQLN2) . Q9UHD9
Ubiquitin-associated domain-containing protein 1 (UBAC1) . Q9BSL1

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(4s)-5-fluoro-l-leucine . DB02542

References

1 An Activity-Based Oxaziridine Platform for Identifying and Developing Covalent Ligands for Functional Allosteric Methionine Sites: Redox-Dependent Inhibition of Cyclin-Dependent Kinase 4. J Am Chem Soc. 2022 Dec 21;144(50):22890-22901. doi: 10.1021/jacs.2c04039. Epub 2022 Dec 9.
2 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
5 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
6 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.