Details of the Target
General Information of Target
| Target ID | LDTP02380 | |||||
|---|---|---|---|---|---|---|
| Target Name | Polyunsaturated fatty acid 5-lipoxygenase (ALOX5) | |||||
| Gene Name | ALOX5 | |||||
| Gene ID | 240 | |||||
| Synonyms |
LOG5; Polyunsaturated fatty acid 5-lipoxygenase; EC 1.13.11.-; Arachidonate 5-lipoxygenase; 5-LO; 5-lipoxygenase; EC 1.13.11.34 |
|||||
| 3D Structure | ||||||
| Sequence |
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY YYLSPDRIPNSVAI |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Lipoxygenase family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Catalyzes the oxygenation of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to 5-hydroperoxyeicosatetraenoate (5-HPETE) followed by the dehydration to 5,6- epoxyeicosatetraenoate (Leukotriene A4/LTA4), the first two steps in the biosynthesis of leukotrienes, which are potent mediators of inflammation. Also catalyzes the oxygenation of arachidonate into 8-hydroperoxyicosatetraenoate (8-HPETE) and 12-hydroperoxyicosatetraenoate (12-HPETE). Displays lipoxin synthase activity being able to convert (15S)-HETE into a conjugate tetraene. Although arachidonate is the preferred substrate, this enzyme can also metabolize oxidized fatty acids derived from arachidonate such as (15S)-HETE, eicosapentaenoate (EPA) such as (18R)- and (18S)-HEPE or docosahexaenoate (DHA) which lead to the formation of specialized pro-resolving mediators (SPM) lipoxin and resolvins E and D respectively, therefore it participates in anti-inflammatory responses. Oxidation of DHA directly inhibits endothelial cell proliferation and sprouting angiogenesis via peroxisome proliferator-activated receptor gamma (PPARgamma). It does not catalyze the oxygenation of linoleic acid and does not convert (5S)-HETE to lipoxin isomers. In addition to inflammatory processes, it participates in dendritic cell migration, wound healing through an antioxidant mechanism based on heme oxygenase-1 (HO-1) regulation expression, monocyte adhesion to the endothelium via ITGAM expression on monocytes. Moreover, it helps establish an adaptive humoral immunity by regulating primary resting B cells and follicular helper T cells and participates in the CD40-induced production of reactive oxygen species (ROS) after CD40 ligation in B cells through interaction with PIK3R1 that bridges ALOX5 with CD40. May also play a role in glucose homeostasis, regulation of insulin secretion and palmitic acid-induced insulin resistance via AMPK. Can regulate bone mineralization and fat cell differentiation increases in induced pluripotent stem cells.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| AGS | SNV: p.L26P | . | |||
| AN3CA | SNV: p.F98L | . | |||
| AU565 | SNV: p.E173K | . | |||
| DU145 | SNV: p.R193S | . | |||
| HEC1 | SNV: p.H126R | . | |||
| IM95 | SNV: p.D291G | . | |||
| MFE319 | SNV: p.S216N | . | |||
| NALM6 | SNV: p.A553T | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C265(1.40) | LDD3312 | [1] | |
|
HPAP Probe Info |
![]() |
3.74 | LDD0064 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C100(0.65) | LDD2182 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C100(0.96) | LDD2187 | [3] |
| LDCM0572 | Fragment10 | Ramos | C100(0.93) | LDD2189 | [3] |
| LDCM0573 | Fragment11 | Ramos | C100(0.18) | LDD2190 | [3] |
| LDCM0574 | Fragment12 | Ramos | C100(0.63) | LDD2191 | [3] |
| LDCM0575 | Fragment13 | Ramos | C100(0.70) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C100(1.60) | LDD2193 | [3] |
| LDCM0579 | Fragment20 | Ramos | C100(0.69) | LDD2194 | [3] |
| LDCM0580 | Fragment21 | Ramos | C100(0.86) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C100(1.06) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C100(0.97) | LDD2197 | [3] |
| LDCM0586 | Fragment28 | Ramos | C100(0.77) | LDD2198 | [3] |
| LDCM0588 | Fragment30 | Ramos | C100(0.83) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C100(0.84) | LDD2200 | [3] |
| LDCM0590 | Fragment32 | Ramos | C100(0.57) | LDD2201 | [3] |
| LDCM0468 | Fragment33 | Ramos | C100(0.73) | LDD2202 | [3] |
| LDCM0596 | Fragment38 | Ramos | C100(0.83) | LDD2203 | [3] |
| LDCM0566 | Fragment4 | Ramos | C100(0.74) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C100(0.72) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C100(0.85) | LDD2205 | [3] |
| LDCM0569 | Fragment7 | Ramos | C100(0.75) | LDD2186 | [3] |
| LDCM0571 | Fragment9 | Ramos | C100(0.71) | LDD2188 | [3] |
| LDCM0022 | KB02 | Ramos | C100(0.65) | LDD2182 | [3] |
| LDCM0023 | KB03 | Ramos | C100(0.85) | LDD2183 | [3] |
| LDCM0024 | KB05 | HMCB | C265(1.40) | LDD3312 | [1] |
| LDCM0014 | Panhematin | hPBMC | 3.74 | LDD0064 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein MOX-1 (MEOX1) | . | P50221 | |||
| Proto-oncogene c-Rel (REL) | . | Q04864 | |||
Other
The Drug(s) Related To This Target
Approved
Phase 4
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| 3,4-dihydroxycinnamic Acid | Small molecular drug | D0V9EN | |||
| Silymarin | Small molecular drug | D0AZ8C | |||
Phase 3
Phase 2
Phase 1
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Bf-389 | Small molecular drug | D0L6VH | |||
| Skf-105809 | Small molecular drug | D0Y4OI | |||
Investigative
Withdrawn from market
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Ibuproxam | Small molecular drug | D0U2CB | |||
Discontinued
References




