Details of the Target

General Information of Target

Target ID LDTP02380
Target Name Polyunsaturated fatty acid 5-lipoxygenase (ALOX5)
Gene Name ALOX5
Gene ID 240
Synonyms
LOG5; Polyunsaturated fatty acid 5-lipoxygenase; EC 1.13.11.-; Arachidonate 5-lipoxygenase; 5-LO; 5-lipoxygenase; EC 1.13.11.34
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
Target Type
Successful
Target Bioclass
Enzyme
Family
Lipoxygenase family
Subcellular location
Cytoplasm
Function
Catalyzes the oxygenation of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to 5-hydroperoxyeicosatetraenoate (5-HPETE) followed by the dehydration to 5,6- epoxyeicosatetraenoate (Leukotriene A4/LTA4), the first two steps in the biosynthesis of leukotrienes, which are potent mediators of inflammation. Also catalyzes the oxygenation of arachidonate into 8-hydroperoxyicosatetraenoate (8-HPETE) and 12-hydroperoxyicosatetraenoate (12-HPETE). Displays lipoxin synthase activity being able to convert (15S)-HETE into a conjugate tetraene. Although arachidonate is the preferred substrate, this enzyme can also metabolize oxidized fatty acids derived from arachidonate such as (15S)-HETE, eicosapentaenoate (EPA) such as (18R)- and (18S)-HEPE or docosahexaenoate (DHA) which lead to the formation of specialized pro-resolving mediators (SPM) lipoxin and resolvins E and D respectively, therefore it participates in anti-inflammatory responses. Oxidation of DHA directly inhibits endothelial cell proliferation and sprouting angiogenesis via peroxisome proliferator-activated receptor gamma (PPARgamma). It does not catalyze the oxygenation of linoleic acid and does not convert (5S)-HETE to lipoxin isomers. In addition to inflammatory processes, it participates in dendritic cell migration, wound healing through an antioxidant mechanism based on heme oxygenase-1 (HO-1) regulation expression, monocyte adhesion to the endothelium via ITGAM expression on monocytes. Moreover, it helps establish an adaptive humoral immunity by regulating primary resting B cells and follicular helper T cells and participates in the CD40-induced production of reactive oxygen species (ROS) after CD40 ligation in B cells through interaction with PIK3R1 that bridges ALOX5 with CD40. May also play a role in glucose homeostasis, regulation of insulin secretion and palmitic acid-induced insulin resistance via AMPK. Can regulate bone mineralization and fat cell differentiation increases in induced pluripotent stem cells.
TTD ID
T00140
Uniprot ID
P09917
DrugMap ID
TT2J34L
Ensemble ID
ENST00000374391.7
HGNC ID
HGNC:435
ChEMBL ID
CHEMBL215

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AGS SNV: p.L26P .
AN3CA SNV: p.F98L .
AU565 SNV: p.E173K .
DU145 SNV: p.R193S .
HEC1 SNV: p.H126R .
IM95 SNV: p.D291G .
MFE319 SNV: p.S216N .
NALM6 SNV: p.A553T DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C265(1.40)  LDD3312  [1]
HPAP
 Probe Info  		3.74  LDD0064  [2]
IA-alkyne
 Probe Info  		C100(0.65)  LDD2182  [3]
ATP probe
 Probe Info  		N.A.  LDD0035  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C100(0.96)  LDD2187  [3]
 LDCM0572  Fragment10 Ramos C100(0.93)  LDD2189  [3]
 LDCM0573  Fragment11 Ramos C100(0.18)  LDD2190  [3]
 LDCM0574  Fragment12 Ramos C100(0.63)  LDD2191  [3]
 LDCM0575  Fragment13 Ramos C100(0.70)  LDD2192  [3]
 LDCM0576  Fragment14 Ramos C100(1.60)  LDD2193  [3]
 LDCM0579  Fragment20 Ramos C100(0.69)  LDD2194  [3]
 LDCM0580  Fragment21 Ramos C100(0.86)  LDD2195  [3]
 LDCM0582  Fragment23 Ramos C100(1.06)  LDD2196  [3]
 LDCM0578  Fragment27 Ramos C100(0.97)  LDD2197  [3]
 LDCM0586  Fragment28 Ramos C100(0.77)  LDD2198  [3]
 LDCM0588  Fragment30 Ramos C100(0.83)  LDD2199  [3]
 LDCM0589  Fragment31 Ramos C100(0.84)  LDD2200  [3]
 LDCM0590  Fragment32 Ramos C100(0.57)  LDD2201  [3]
 LDCM0468  Fragment33 Ramos C100(0.73)  LDD2202  [3]
 LDCM0596  Fragment38 Ramos C100(0.83)  LDD2203  [3]
 LDCM0566  Fragment4 Ramos C100(0.74)  LDD2184  [3]
 LDCM0610  Fragment52 Ramos C100(0.72)  LDD2204  [3]
 LDCM0614  Fragment56 Ramos C100(0.85)  LDD2205  [3]
 LDCM0569  Fragment7 Ramos C100(0.75)  LDD2186  [3]
 LDCM0571  Fragment9 Ramos C100(0.71)  LDD2188  [3]
 LDCM0022  KB02 Ramos C100(0.65)  LDD2182  [3]
 LDCM0023  KB03 Ramos C100(0.85)  LDD2183  [3]
 LDCM0024  KB05 HMCB C265(1.40)  LDD3312  [1]
 LDCM0014  Panhematin hPBMC 3.74  LDD0064  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial (GATC) GatC family O43716
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA) AGC Ser/Thr protein kinase family P17612
Tyrosine-protein kinase Fgr (FGR) Tyr protein kinase family P09769
Tyrosine-protein kinase HCK (HCK) Tyr protein kinase family P08631
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
17-beta-hydroxysteroid dehydrogenase type 1 (HSD17B1) Short-chain dehydrogenases/reductases (SDR) family P14061
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein MOX-1 (MEOX1) . P50221
Proto-oncogene c-Rel (REL) . Q04864
Other
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Coactosin-like protein (COTL1) Actin-binding proteins ADF family Q14019
Lipocalin-1 (LCN1) Lipocalin family P31025
Centrosomal protein of 63 kDa (CEP63) CEP63 family Q96MT8
HHIP-like protein 2 (HHIPL2) HHIP family Q6UWX4
Oocyte-expressed protein homolog (OOEP) KHDC1 family A6NGQ2
Mitotic spindle assembly checkpoint protein MAD1 (MAD1L1) MAD1 family Q9Y6D9
NUT family member 1 (NUTM1) NUT family Q86Y26
Synaptonemal complex central element protein 1 (SYCE1) SYCE family Q8N0S2
Coiled-coil domain-containing protein 174 (CCDC174) . Q6PII3
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TBC1 domain family member 7 (TBC1D7) . Q9P0N9

The Drug(s) Related To This Target

Approved
Click To Hide/Show 19 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Aminosalicylic Acid Small molecular drug DB00233
Balsalazide Small molecular drug DB01014
Cannabidiol Small molecular drug DB09061
Diacerein Small molecular drug DB11994
Diclofenac Small molecular drug DB00586
Diethylcarbamazine Small molecular drug D06RCB
Fostamatinib Small molecular drug DB12010
Icosapent Small molecular drug DB00159
Masoprocol Small molecular drug DB00179
Meclofenamic Acid Small molecular drug DB00939
Mesalazine Small molecular drug DB00244
Minocycline Small molecular drug DB01017
Montelukast Small molecular drug DB00471
Sulfasalazine Small molecular drug DB00795
Vitamin E Small molecular drug DB00163
Zileuton Small molecular drug D09JUG
Alpha-tocopherol Succinate . DB14001
D-alpha-tocopherol Acetate . DB14002
Omega-3 Fatty Acids . DB11133
Phase 4
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
3,4-dihydroxycinnamic Acid Small molecular drug D0V9EN
Silymarin Small molecular drug D0AZ8C
Phase 3
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Abt-761 Small molecular drug D08PXR
Avastin+/-tarceva Small molecular drug D0C0NH
Darbufelone Small molecular drug D0AL8T
Flobufen Small molecular drug D0X8VV
Fpl-62064 Small molecular drug D02YEY
Tenidap Small molecular drug D02RQT
Phase 2
Click To Hide/Show 14 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Baicalein Small molecular drug D00YEV
Bim23a760 Small molecular drug D04FNQ
Cmi-392 Small molecular drug D0D5ZV
Pf-4191834 Small molecular drug D0L5XG
Ptc299 Small molecular drug D05VVX
Q301 Small molecular drug DES36M
Rilopirox Small molecular drug D00RJB
Tepoxalin Small molecular drug D04WMR
Tipelukast Small molecular drug D0Q7UG
Wy-50295-tromethamine Small molecular drug D0A7JH
E-6700 . D0K9UK
Mk-866 . D0S2PY
Ta-270 . D0L4SL
Ucb-35440 . D04JIM
Phase 1
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Bf-389 Small molecular drug D0L6VH
Skf-105809 Small molecular drug D0Y4OI
Investigative
Click To Hide/Show 120 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
1,2-dihydro-indazol-3-one Small molecular drug D0H6JC
1,2-dihydroxy-10h-anthracen-9-one Small molecular drug D02YPE
1,3,8-trihydroxy-6-methyl-10h-anthracen-9-one Small molecular drug D00BSX
1,5-dihydroxy-10h-anthracen-9-one Small molecular drug D0Y0KF
1,8,9-trimethoxy-9,10-dihydro-anthracene Small molecular drug D07OKS
1,8-dichloro-10h-anthracen-9-one Small molecular drug D04MBD
1,8-dihydroxy-2-propionyl-10h-anthracen-9-one Small molecular drug D00ENR
1-benzyl-1,2-dihydro-indazol-3-one Small molecular drug D04RQG
1-furan-2-yl-3-pyridin-2-yl-propenone (Fpp-3) Small molecular drug D0B0XK
1-hydroxy-10h-anthracen-9-one Small molecular drug D0P8IX
1-hydroxy-8-methoxy-10h-anthracen-9-one Small molecular drug D06CWX
1-methyl-1,2-dihydro-indazol-3-one Small molecular drug D0A9HL
10-acetyl-1,8-dihydroxy-10h-anthracen-9-one Small molecular drug D08FPY
10-benzoyl-1,8-dihydroxy-10h-anthracen-9-one Small molecular drug D06XYZ
15-hydroxyeicosatetraenoic Acid Small molecular drug D01VLQ
2'-nitro-biphenyl-4-carboxylic Acid Hydroxyamide Small molecular drug D0PD7X
2-(1h-indol-3-ylmethyl)-1,2-dihydro-indazol-3-one Small molecular drug D0R1ER
2-(3-phenyl-propyl)-1,2-dihydro-indazol-3-one Small molecular drug D0L4TM
2-(4-butoxy-phenoxy)-n-hydroxy-acetamide Small molecular drug D0X8BS
2-(4-butoxy-phenoxy)-n-hydroxy-n-methyl-acetamide Small molecular drug D0T0CY
2-(4-butoxy-phenoxy)-n-hydroxy-propionamide Small molecular drug D0N6CN
2-(4-butoxy-phenyl)-n-hydroxy-n-methyl-acetamide Small molecular drug D0IF2H
2-(4-hydroxylphenyl)-3-(3,5-dihydroxylphenyl) Propenoic Acid (Nnu-hdpa) Small molecular drug D0WW1K
2-(4-methoxy-phenyl)-5-phenyl-thiazol-4-ol Small molecular drug D05PHI
2-(4-phenyl-butyl)-1,2-dihydro-indazol-3-one Small molecular drug D08MCE
2-benzyl-1,2-dihydro-indazol-3-one Small molecular drug D0J7YU
2-biphenyl-4-yl-n-hydroxy-n-methyl-acetamide Small molecular drug D02HQK
2-furan-2-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0SJ3W
2-methyl-1,2-dihydro-indazol-3-one Small molecular drug D0U8CM
2-naphthalen-1-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0F1ZE
2-naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0X6SA
2-phenethyl-1,2-dihydro-indazol-3-one Small molecular drug D06HUQ
2-phenyl-1,2-dihydro-indazol-3-one Small molecular drug D0S0PB
2-pyridin-2-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D05KCN
2-pyridin-3-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0HZ9X
2-pyridin-4-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0Z5XD
2-thiazol-5-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0XQ8P
2-thiophen-2-ylmethyl-1,2-dihydro-indazol-3-one Small molecular drug D0X9RM
3,4-dihydroxy-10h-anthracen-9-one Small molecular drug D0S8UP
3-(4-butoxy-phenyl)-n-hydroxy-n-methyl-acrylamide Small molecular drug D08UXT
3-benzoyl-n-hydroxy-benzamide Small molecular drug D05RIE
3-biphenyl-3-yl-n-hydroxy-n-methyl-acrylamide Small molecular drug D09WYM
3-biphenyl-4-yl-n-hydroxy-n-methyl-acrylamide Small molecular drug D02TLZ
4,5-dihydroxy-10h-anthracen-9-one Small molecular drug D0S6XY
4,5-dimethoxy-10h-anthracen-9-one Small molecular drug D08BNV
4-(1h-indol-3-yl)-1-morpholinobutan-1-one Small molecular drug D08NDV
4-bromo-n-hydroxy-benzamide Small molecular drug D0J7AM
4-butoxy-n-hydroxy-n-methyl-benzamide Small molecular drug D02RBU
4-hydroxy-5-methoxy-10h-anthracen-9-one Small molecular drug D01QDG
4-pentadeca-1,3,6-trienylsulfanyl-butyric Acid Small molecular drug D0R2XE
5,8-dihydroxy-1,4-naphthoquinone Small molecular drug D0AS0V
5-chloro-n-(4-ethylphenyl)Benzo[D]Oxazol-2-amine Small molecular drug D0U9UL
5-chloro-n-phenylbenzo[D]Oxazol-2-amine Small molecular drug D08HFK
5-methoxy-n-phenylbenzo[D]Oxazol-2-amine Small molecular drug D0XL5D
5-methyl-2-p-tolyl-thiazol-4-ol Small molecular drug D04IFV
5-methyl-n-phenylbenzo[D]Oxazol-2-amine Small molecular drug D0H4MV
5s-hete Small molecular drug D07CJR
7-tert-butyl-2, 3-dihydro-3, 3-dimethyl Substituted Dihydrofuran 30 (Dhdmbf30) Small molecular drug D02COM
Acacetin Small molecular drug D0NS1S
Acanthus Ilicifolius Linn Small molecular drug D09CXQ
Acetic Acid 2-phenyl-5-propyl-thiazol-4-yl Ester Small molecular drug D0C1XI
Acetic Acid 5-butyl-2-phenyl-thiazol-4-yl Ester Small molecular drug D0G3VE
Anthracene-2-carboxylic Acid Hydroxyamide Small molecular drug D0CT9V
Anthrone Small molecular drug D0C6BU
Biphenyl-3-carboxylic Acid Hydroxyamide Small molecular drug D05QBX
Biphenyl-4-carboxylic Acid Hydroxyamide Small molecular drug D04XPJ
Buddledin A Small molecular drug D0O7SM
Bw A360c Small molecular drug D03QNE
Bw B218c Small molecular drug D0PU1J
Bw-a137c Small molecular drug D0M6UM
Cgs-23885 Small molecular drug D0U2YL
Chebulagic Acid Small molecular drug D0J5OV
Cylindol A Small molecular drug D0K3AO
Heme Small molecular drug D0UU1I
Hexanoic Acid 2,5-diphenyl-thiazol-4-yl Ester Small molecular drug D0T8TS
Hyperforin Small molecular drug D09VTJ
Ici-211965 Small molecular drug D0F4HT
L-652,343 Small molecular drug D00OWE
Morniflumate Small molecular drug DB09285
N-(2-ethylphenyl)-5-methylbenzo[D]Oxazol-2-amine Small molecular drug D0E3CO
N-(3-bromophenyl)-5-methoxybenzo[D]Oxazol-2-amine Small molecular drug D0C4KD
N-(4-ethylphenyl)-5-methylbenzo[D]Oxazol-2-amine Small molecular drug D07XMM
N-(4-ethylphenyl)Benzo[D]Oxazol-2-amine Small molecular drug D05GZI
N-hydroxy-2-methyl-3-naphthalen-2-yl-acrylamide Small molecular drug D0I9RY
N-hydroxy-2-naphthalen-2-yl-acetamide Small molecular drug D0KB6Q
N-hydroxy-3-naphthalen-2-yl-acrylamide Small molecular drug D09PDD
N-hydroxy-3-naphthalen-2-yl-n-p-tolyl-acrylamide Small molecular drug D06AFD
N-hydroxy-3-naphthalen-2-yl-n-phenyl-acrylamide Small molecular drug D0T1HY
N-hydroxy-3-naphthalen-2-yl-propionamide Small molecular drug D0H7UQ
N-hydroxy-3-phenyl-acrylamide Small molecular drug D07MYE
N-hydroxy-4-(Naphthalen-1-yl)Benzamide Small molecular drug D03HNC
N-hydroxy-4-iodo-benzamide Small molecular drug D06MUA
N-hydroxy-4-isobutyl-benzamide Small molecular drug D0L3BQ
N-hydroxy-4-naphthalen-2-yl-benzamide Small molecular drug D0K7XU
N-hydroxy-n-methyl-2,3,3-triphenyl-acrylamide Small molecular drug D06GRW
N-hydroxy-n-methyl-2-naphthalen-2-yl-propionamide Small molecular drug D07PCS
N-hydroxy-n-methyl-3-naphthalen-1-yl-acrylamide Small molecular drug D0V8UV
N-hydroxy-n-methyl-3-naphthalen-2-yl-acrylamide Small molecular drug D0E4JU
N-hydroxy-n-methyl-3-naphthalen-2-yl-propionamide Small molecular drug D06KQD
N-hydroxy-n-methyl-3-phenanthren-2-yl-acrylamide Small molecular drug D0C7GT
N-hydroxy-n-methyl-3-phenanthren-3-yl-acrylamide Small molecular drug D0E1NK
N-hydroxy-n-methyl-3-phenanthren-9-yl-acrylamide Small molecular drug D0O6OJ
N-hydroxy-n-methyl-benzamide Small molecular drug D0A2QP
N-hydroxy-n-[1-(4-isobutylphenyl)Ethyl]Urea Small molecular drug D0K7XQ
N-phenylbenzo[D]Oxazol-2-amine Small molecular drug D00JPV
Nabiximols Small molecular drug DB14011
Naphthalene-2-carboxylic Acid Hydroxyamide Small molecular drug D04UJI
Phenanthrene-2-carboxylic Acid Hydroxyamide Small molecular drug D0DP9F
Phenanthrene-3-carboxylic Acid Hydroxyamide Small molecular drug D04ZGR
Phenidone Small molecular drug D0P1LP
Pyrogallol Small molecular drug D06TPF
Resveratrol Small molecular drug DB02709
Rhein Small molecular drug DB13174
Sb-202235 Small molecular drug D0Z0ZM
Sc-41661a Small molecular drug D00XKA
Sk&f 107649 Small molecular drug D07LMV
Tzi-41127 Small molecular drug D01SQY
Bw-858c . D0R2MQ
Fr-122788 . D00MIM
Medical Cannabis . DB14009
Withdrawn from market
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ibuproxam Small molecular drug D0U2CB
Discontinued
Click To Hide/Show 47 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
A-78773 Small molecular drug D0X9KE
A-79175 Small molecular drug D0L1IH
Aa-861 Small molecular drug D06XRQ
Bi-l-357 Small molecular drug D0U6AL
Bu-4601a Small molecular drug D0C9RZ
Bw A4c Small molecular drug D05WPQ
Bw B70c Small molecular drug D0HJ1Y
Bw755c Small molecular drug D0DP8P
Cgs 8515 Small molecular drug D0QI8I
Ci-986 Small molecular drug D0L8RG
Cj-13610 Small molecular drug D01DAD
Cv-6504 Small molecular drug D0V3HG
Dup-654 Small molecular drug D06UVO
E-3040 Small molecular drug D0JY4Y
E-6080 Small molecular drug D00HFD
Epocarbazolin-a Small molecular drug D09JYF
Er-34122 Small molecular drug D0SZ3B
Eth615 Small molecular drug D0H7GH
Licofelone Small molecular drug D0N1SU
Linetastine Small molecular drug D0E8UV
Ly-221068 Small molecular drug D01QAR
Mk-591 Small molecular drug D0M0QX
Mk-886 Small molecular drug D0K2ER
Mln-977 Small molecular drug D0P1TZ
Nafazatrom Small molecular drug D0H2RB
Opc-21268 Small molecular drug D08ORO
Pd-146176 Small molecular drug D0J8RS
R-68151 Small molecular drug D0G5GJ
R-85355 Small molecular drug D0S5DY
Rev-5901 Small molecular drug D0O8ZE
Sc-45662 Small molecular drug D0U5EU
Sch-40120 Small molecular drug D06MPF
Skf-104351 Small molecular drug D09SCI
Tebufelone Small molecular drug D0P3KA
Zm-230487 Small molecular drug D0D8MD
A-80263 . D0T4EL
Azd-4407 . D0P3CF
Cd-581 . D0F5NB
Cgs-26529 . D02QGM
Cmi-206 . D0V4GT
Fpl-64170 . D04QVN
Kc-11404 . D04APY
Kc-11425 . D01LXG
R Zileuton . D0C5HV
Rwj-63556 . D08JKK
Wy-28342 . D0H0IA
Zd-7717 . D06YOD

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 A Chemical Proteomic Map of Heme-Protein Interactions. J Am Chem Soc. 2022 Aug 24;144(33):15013-15019. doi: 10.1021/jacs.2c06104. Epub 2022 Aug 12.
Mass spectrometry data entry: PXD034651
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
4 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096