Details of the Target

General Information of Target

Target ID LDTP02304
Target Name Keratin, type I cytoskeletal 19 (KRT19)
Gene Name KRT19
Gene ID 3880
Synonyms
Keratin, type I cytoskeletal 19; Cytokeratin-19; CK-19; Keratin-19; K19
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Target Type
Literature-reported
Target Bioclass
Other
Family
Intermediate filament family
Function Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
TTD ID
T54461
Uniprot ID
P08727
DrugMap ID
TT3JF9E
Ensemble ID
ENST00000361566.7
HGNC ID
HGNC:6436

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-4
 Probe Info  		100.00  LDD0445  [1]
1oxF11yne
 Probe Info  		N.A.  LDD0193  [2]
ONAyne
 Probe Info  		K111(7.84); K140(10.00); K168(5.21); K216(0.75)  LDD0274  [3]
STPyne
 Probe Info  		K118(7.75); K140(10.00); K168(0.78); K208(6.67)  LDD0277  [3]
OPA-S-S-alkyne
 Probe Info  		K140(2.21); K398(2.38); K118(3.16); K370(3.40)  LDD3494  [4]
Acrolein
 Probe Info  		N.A.  LDD0221  [5]
CY-1
 Probe Info  		D96(0.00); R99(0.00)  LDD0246  [6]
ATP probe
 Probe Info  		K168(0.00); K216(0.00); K215(0.00); K398(0.00)  LDD0035  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H218(0.00); H390(0.00)  LDD0222  [5]
 LDCM0107  IAA HeLa N.A.  LDD0221  [5]
 LDCM0109  NEM HeLa N.A.  LDD0225  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Dopamine beta-hydroxylase (DBH) Copper type II ascorbate-dependent monooxygenase family P09172
COP9 signalosome complex subunit 4 (COPS4) CSN4 family Q9BT78
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Beta-secretase 2 (BACE2) Peptidase A1 family Q9Y5Z0
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
Serine protease HTRA2, mitochondrial (HTRA2) Peptidase S1C family O43464
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Protein kinase C gamma type (PRKCG) AGC Ser/Thr protein kinase family P05129
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
ADP-ribosylation factor-like protein 4A (ARL4A) Arf family P40617
GTPase HRas (HRAS) Ras family P01112
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Protein-glutamine gamma-glutamyltransferase 2 (TGM2) Transglutaminase family P21980
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Eukaryotic translation initiation factor 4E transporter (EIF4ENIF1) 4E-T/EIF4E-T family Q9NRA8
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Huntingtin (HTT) Huntingtin family P42858
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
SNARE-associated protein Snapin (SNAPIN) SNAPIN family O95295
Dystrophin (DMD) . P11532
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
Other
Click To Hide/Show 39 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Abl interactor 2 (ABI2) ABI family Q9NYB9
Protein BEX2 (BEX2) BEX family Q9BXY8
Eukaryotic translation initiation factor 4E type 2 (EIF4E2) Eukaryotic initiation factor 4E family O60573
Protein FAM124B (FAM124B) FAM124 family Q9H5Z6
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type II cuticular Hb1 (KRT81) Intermediate filament family Q14533
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 1b (KRT77) Intermediate filament family Q7Z794
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 5 (KRT5) Intermediate filament family P13647
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6B (KRT6B) Intermediate filament family P04259
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 72 (KRT72) Intermediate filament family Q14CN4
Keratin, type II cytoskeletal 74 (KRT74) Intermediate filament family Q7RTS7
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Peripherin (PRPH) Intermediate filament family P41219
SAGA-associated factor 29 (SGF29) SGF29 family Q96ES7
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
Gelsolin (GSN) Villin/gelsolin family P06396
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Phostensin (PPP1R18) . Q6NYC8
Placental protein 13-like (LGALS14) . Q8TCE9
Protocadherin beta-12 (PCDHB12) . Q9Y5F1
TBC1 domain family member 7 (TBC1D7) . Q9P0N9

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
2 An Activity-Based Oxaziridine Platform for Identifying and Developing Covalent Ligands for Functional Allosteric Methionine Sites: Redox-Dependent Inhibition of Cyclin-Dependent Kinase 4. J Am Chem Soc. 2022 Dec 21;144(50):22890-22901. doi: 10.1021/jacs.2c04039. Epub 2022 Dec 9.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
5 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
6 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
7 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096